DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7-like and RPL7

DIOPT Version :9

Sequence 1:NP_001097151.1 Gene:RpL7-like / 34625 FlyBaseID:FBgn0032404 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_000962.2 Gene:RPL7 / 6129 HGNCID:10363 Length:248 Species:Homo sapiens


Alignment Length:249 Identity:82/249 - (32%)
Similarity:135/249 - (54%) Gaps:18/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LKHRKRRILQDESVVTQKRND-------RIKKRTATKNHHKFRRAESFVMGYLKAERTSKRIKQT 76
            ::.:|:.:......:.:||.:       |::|:.|.|...|.||.    :.|.||:...|..:| 
Human     4 VEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRK----LIYEKAKHYHKEYRQ- 63

  Fly    77 ILRTNV--TEQSAKAAD---DSNPKLLFVMRHAGKKIFDKTTADIFRTLRMGSRHNAVFMENTKE 136
            :.||.:  ...:.||.:   .:.|||.||:|..|..........:.:.||:....|..|::..|.
Human    64 MYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKA 128

  Fly   137 NQLLLRVIEPFVVYGNPSLSSIRELVFKKGFARIDGKKTAIQSNTMVEQQLGDKGVICLEDIIHE 201
            :..:||::||::.:|.|:|.|:.||::|:|:.:|:.|:.|:..|.::.:.||..|:||:||:|||
Human   129 SINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHE 193

  Fly   202 ICTVGPNFAAVNEFLCAFTLSSPSNGWQKKVSVSYKRGGEYGDRGTAINELIAR 255
            |.|||..|...|.||..|.||||..|.:|| :..:..||:.|:|...||.||.|
Human   194 IYTVGKRFKEANNFLWPFKLSSPRGGMKKK-TTHFVEGGDAGNREDQINRLIRR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7-likeNP_001097151.1 uL30_euk 18..257 CDD:273548 82/249 (33%)
Ribosomal_L7_archeal_euk 97..257 CDD:100099 61/159 (38%)
RPL7NP_000962.2 4 X 12 AA tandem repeats 7..54 11/50 (22%)
uL30_euk 16..248 CDD:273548 81/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S407
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001677
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.