powered by:
Protein Alignment RpL7-like and CG34164
DIOPT Version :9
Sequence 1: | NP_001097151.1 |
Gene: | RpL7-like / 34625 |
FlyBaseID: | FBgn0032404 |
Length: | 257 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097152.1 |
Gene: | CG34164 / 5740394 |
FlyBaseID: | FBgn0085193 |
Length: | 106 |
Species: | Drosophila melanogaster |
Alignment Length: | 39 |
Identity: | 9/39 - (23%) |
Similarity: | 17/39 - (43%) |
Gaps: | 5/39 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 SKRIKQTILRTNVT-----EQSAKAADDSNPKLLFVMRH 103
::.:|:.||..:.. |||.....|::...:.|..|
Fly 22 ARSLKEPILGKHFALPGRIEQSPPIELDTSQSYIAVYTH 60
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1841 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.