DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7-like and CG34164

DIOPT Version :9

Sequence 1:NP_001097151.1 Gene:RpL7-like / 34625 FlyBaseID:FBgn0032404 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001097152.1 Gene:CG34164 / 5740394 FlyBaseID:FBgn0085193 Length:106 Species:Drosophila melanogaster


Alignment Length:39 Identity:9/39 - (23%)
Similarity:17/39 - (43%) Gaps:5/39 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SKRIKQTILRTNVT-----EQSAKAADDSNPKLLFVMRH 103
            ::.:|:.||..:..     |||.....|::...:.|..|
  Fly    22 ARSLKEPILGKHFALPGRIEQSPPIELDTSQSYIAVYTH 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7-likeNP_001097151.1 uL30_euk 18..257 CDD:273548 9/39 (23%)
Ribosomal_L7_archeal_euk 97..257 CDD:100099 2/7 (29%)
CG34164NP_001097152.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.