DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7-like and rpl7

DIOPT Version :9

Sequence 1:NP_001097151.1 Gene:RpL7-like / 34625 FlyBaseID:FBgn0032404 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_998809.1 Gene:rpl7 / 336710 ZFINID:ZDB-GENE-030131-8654 Length:246 Species:Danio rerio


Alignment Length:255 Identity:90/255 - (35%)
Similarity:136/255 - (53%) Gaps:27/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLPGKTVSVLKHRKRRILQDESVVTQKRNDRIKKRTATKNHHK------FRRAESFVMGYLKAER 68
            |:|....|:||.|:|        ....|..|:||..|.|...|      |:|||::...|.:..|
Zfish     8 KIPSVPESLLKRRQR--------FAAIRAVRLKKAKADKKASKVTRKLIFKRAEAYHKEYKQLYR 64

  Fly    69 TSKRIKQTILRTNVTEQSAKAAD---DSNPKLLFVMRHAGKKIFDKTTADIFRTLRMGSRHNAVF 130
            ...|         ::..:.||.:   .:.|||.||:|..|..........:.:.||:....|.||
Zfish    65 REIR---------MSRMARKAGNYYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGVF 120

  Fly   131 MENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFARIDGKKTAIQSNTMVEQQLGDKGVICL 195
            ::..|.:..:||:.||::.:|.|:|.|:|||::|:||.:|..::.|:..|:::|:.||..|:||:
Zfish   121 VKLNKASINMLRIAEPYIAWGYPNLKSVRELIYKRGFGKIKKQRIALTDNSLIEKTLGQCGIICI 185

  Fly   196 EDIIHEICTVGPNFAAVNEFLCAFTLSSPSNGWQKKVSVSYKRGGEYGDRGTAINELIAR 255
            ||:||||.|||.||.|.|.||..|.||||..|..|| :..:..||:.|:|...||.|:.|
Zfish   186 EDLIHEIYTVGKNFKAANNFLWPFKLSSPRGGMNKK-TTHFVEGGDAGNREDQINRLVRR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7-likeNP_001097151.1 uL30_euk 18..257 CDD:273548 87/247 (35%)
Ribosomal_L7_archeal_euk 97..257 CDD:100099 65/159 (41%)
rpl7NP_998809.1 uL30_euk 14..246 CDD:273548 88/249 (35%)
Ribosomal_L30_N 15..85 CDD:285340 21/86 (24%)
Ribosomal_L7_archeal_euk 87..246 CDD:100099 65/159 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001677
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.