DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7-like and rpl7l1

DIOPT Version :9

Sequence 1:NP_001097151.1 Gene:RpL7-like / 34625 FlyBaseID:FBgn0032404 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_955884.1 Gene:rpl7l1 / 322251 ZFINID:ZDB-GENE-030131-970 Length:247 Species:Danio rerio


Alignment Length:241 Identity:76/241 - (31%)
Similarity:126/241 - (52%) Gaps:13/241 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SVLKHRK--RRILQDESVVTQKRNDRIKKRTATKNHHKFRRAESFVMGYLKAERTSKRIKQTILR 79
            ::||.||  :.|..:::.:..::..|::|...    .||:|.|.|:....:..|...|:.:...|
Zfish    16 NLLKKRKAYQAIKANQAKLALQQKKRVQKGIP----FKFKRLEEFLQNSRRKHRDETRLARLKKR 76

  Fly    80 TNVTEQSAKAADDSNPKLLFVMRHAGKKIFDKTTADIFRTLRMGSRHNAVFMENTKENQLLLRVI 144
            .......||.:      |.|.:|....|.......::.:.||:....:..|::.:|.:..:|:.:
Zfish    77 PPPPMPPAKNS------LAFAVRIREIKGVSPKVMNVIQMLRLRKIFSGTFVKVSKHSINMLKTV 135

  Fly   145 EPFVVYGNPSLSSIRELVFKKGFARIDGKKTAIQSNTMVEQQLGDKGVICLEDIIHEICTVGPNF 209
            ||:|.:|.|:|.|:|||:.|:|..::|.:|..:..||::||.||..|:|||||:||||.:.|.||
Zfish   136 EPYVAWGYPNLKSVRELILKRGQGKVDKRKIPLTDNTLIEQHLGKYGIICLEDLIHEIYSAGKNF 200

  Fly   210 AAVNEFLCAFTLSSPSNGWQKKVSVSYKRGGEYGDRGTAINELIAR 255
            ..||.||..|.||.|.:..:.||.: .|..|..|.|...||.:|.:
Zfish   201 RVVNNFLWPFRLSVPRHAARDKVGL-MKDVGNPGPRAEDINTVIRK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7-likeNP_001097151.1 uL30_euk 18..257 CDD:273548 76/240 (32%)
Ribosomal_L7_archeal_euk 97..257 CDD:100099 59/159 (37%)
rpl7l1NP_955884.1 uL30_euk 15..247 CDD:273548 76/241 (32%)
Ribosomal_L30_N 16..75 CDD:285340 14/62 (23%)
Ribosomal_L7_archeal_euk 88..247 CDD:100099 59/159 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.