DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7-like and Npsr1

DIOPT Version :10

Sequence 1:NP_609543.2 Gene:RpL7-like / 34625 FlyBaseID:FBgn0032404 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_783609.1 Gene:Npsr1 / 319239 MGIID:2441738 Length:371 Species:Mus musculus


Alignment Length:47 Identity:9/47 - (19%)
Similarity:24/47 - (51%) Gaps:14/47 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 RHNAV-----FMENTKENQLLLRV---------IEPFVVYGNPSLSS 157
            |::|:     |::..|:.::|:.:         |...:::|..:||:
Mouse   146 RYHAIVYPMKFLQGEKQAKVLIGIAWSLSFLFSIPTLIIFGKRTLSN 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7-likeNP_609543.2 uL30_euk 18..257 CDD:273548 9/47 (19%)
Npsr1NP_783609.1 7tmA_NPSR 50..341 CDD:320325 9/47 (19%)
TM helix 1 51..77 CDD:320325
TM helix 2 83..110 CDD:320325
TM helix 3 121..151 CDD:320325 2/4 (50%)
TM helix 4 162..183 CDD:320325 2/20 (10%)
TM helix 5 207..236 CDD:320325
TM helix 6 267..297 CDD:320325
TM helix 7 309..334 CDD:320325
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.