powered by:
Protein Alignment RpL7-like and Npsr1
DIOPT Version :9
Sequence 1: | NP_001097151.1 |
Gene: | RpL7-like / 34625 |
FlyBaseID: | FBgn0032404 |
Length: | 257 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001100278.1 |
Gene: | Npsr1 / 300458 |
RGDID: | 1564154 |
Length: | 371 |
Species: | Rattus norvegicus |
Alignment Length: | 47 |
Identity: | 9/47 - (19%) |
Similarity: | 24/47 - (51%) |
Gaps: | 14/47 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 RHNAV-----FMENTKENQLLLRV---------IEPFVVYGNPSLSS 157
|::|: |::..|:.::|:.: |...:::|..:||:
Rat 146 RYHAIVYPMKFLQGEKQAKVLIGIAWSLSFLFSIPTLIIFGKRTLSN 192
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1841 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.