DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7-like and RPL7L1

DIOPT Version :9

Sequence 1:NP_001097151.1 Gene:RpL7-like / 34625 FlyBaseID:FBgn0032404 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001353410.1 Gene:RPL7L1 / 285855 HGNCID:21370 Length:255 Species:Homo sapiens


Alignment Length:249 Identity:83/249 - (33%)
Similarity:135/249 - (54%) Gaps:19/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLPGKTVSVLKHRKR-RILQDESVVTQKRNDRIKKRTATKNHH-KFRRAESFVMGYLKAERTSKR 72
            |:|....::||.||. :.|:    .||.:...:.|:...|... :|:|.|||:....:.:|...|
Human    17 KIPLVPENLLKKRKAYQALK----ATQAKQALLAKKEQKKGKGLRFKRLESFLHDSWRQKRDKVR 77

  Fly    73 IKQTILRTNVTEQSAKAADDSNPKLLFVMRHAGKKIFDKTTADIFRT---LRMGSRHNAVFMENT 134
            :::..::.:..|...|.:      |.||:|   .:..|..:..:.||   ||:....:.||::.|
Human    78 LRRLEVKPHALELPDKHS------LAFVVR---IERIDGVSLLVQRTIARLRLKKIFSGVFVKVT 133

  Fly   135 KENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFARIDGKKTAIQSNTMVEQQLGDKGVICLEDII 199
            .:|..:||::||:|.:|.|:|.|:|||:.|:|.|::..|...:..||::|:.||..|||||||:|
Human   134 PQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKNKTIPLTDNTVIEEHLGKFGVICLEDLI 198

  Fly   200 HEICTVGPNFAAVNEFLCAFTLSSPSNGWQKKVSVSYKRGGEYGDRGTAINELI 253
            |||...|.:|..::.|||.|.||...:..:.:|.. .|..|..|.||..||:||
Human   199 HEIAFPGKHFQEISWFLCPFHLSVARHATKNRVGF-LKEMGTPGYRGERINQLI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7-likeNP_001097151.1 uL30_euk 18..257 CDD:273548 81/241 (34%)
Ribosomal_L7_archeal_euk 97..257 CDD:100099 63/160 (39%)
RPL7L1NP_001353410.1 uL30_euk 23..255 CDD:273548 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.