DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7-like and Rpl7

DIOPT Version :9

Sequence 1:NP_001097151.1 Gene:RpL7-like / 34625 FlyBaseID:FBgn0032404 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_035421.2 Gene:Rpl7 / 19989 MGIID:98073 Length:270 Species:Mus musculus


Alignment Length:261 Identity:87/261 - (33%)
Similarity:140/261 - (53%) Gaps:18/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VPNKLPGKTVSVLKHRKRRILQDESVVTQKRND-------RIKKRTATKNHHKFRRAESFVMGYL 64
            ||..|..|..:..|..|:::......:.:||.:       |::|:.|.|...|.||.    :.|.
Mouse    14 VPGTLKKKVPAGPKTLKKKVPAVPETLKKKRRNFAELKVKRLRKKFALKTLRKARRK----LIYE 74

  Fly    65 KAERTSKRIKQTILRTNV--TEQSAKAAD---DSNPKLLFVMRHAGKKIFDKTTADIFRTLRMGS 124
            ||:...|..:| :.||.:  ...:.||.:   .:.|||.||:|..|..........:.:.||:..
Mouse    75 KAKHYHKEYRQ-MYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQ 138

  Fly   125 RHNAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFARIDGKKTAIQSNTMVEQQLGD 189
            ..|..|::..|.:..:||::||::.:|.|:|.|:.||::|:|:.:|:.|:.|:..|:::.:.||.
Mouse   139 IFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLIARSLGK 203

  Fly   190 KGVICLEDIIHEICTVGPNFAAVNEFLCAFTLSSPSNGWQKKVSVSYKRGGEYGDRGTAINELIA 254
            .|:||:||:||||.|||..|...|.||..|.||||..|.:|| :..:..||:.|:|...||.||.
Mouse   204 FGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKK-TTHFVEGGDAGNREDQINRLIR 267

  Fly   255 R 255
            |
Mouse   268 R 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7-likeNP_001097151.1 uL30_euk 18..257 CDD:273548 83/250 (33%)
Ribosomal_L7_archeal_euk 97..257 CDD:100099 61/159 (38%)
Rpl7NP_035421.2 6 X 12 AA tandem repeats 7..76 16/65 (25%)
uL30_euk 38..270 CDD:273548 81/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001677
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.