DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-21 and TAT1

DIOPT Version :9

Sequence 1:NP_001245996.1 Gene:JhI-21 / 34624 FlyBaseID:FBgn0028425 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_009625.1 Gene:TAT1 / 852361 SGDID:S000000273 Length:619 Species:Saccharomyces cerevisiae


Alignment Length:426 Identity:97/426 - (22%)
Similarity:171/426 - (40%) Gaps:79/426 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGNPNPADGEEKIVLKRKLTLINGVAIIVGTIIGSGIFIAPTGVFIYTESVGSSLL------IWL 81
            |...:..:.:||..|.:.:...:.|.|.:||.||:|:.:. .|..:.|......:|      |.|
Yeast    76 PDRNSELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVG-NGQVLGTAGPAGLVLGYGIASIML 139

  Fly    82 TCGILSTIG--ALCYAELGTCITRSGGDYAYLLVSFGPLVGF---LRLWIALLIIRPTTQTIVAL 141
            .| |:...|  .||||.|....||    |..:||.  |.:||   :...|..|.:.|......|:
Yeast   140 YC-IIQAAGELGLCYAGLTGNYTR----YPSILVD--PSLGFAVSVVYTIQWLTVLPLQLVTAAM 197

  Fly   142 SFAHYAVKPFFPECDPPQNAVKLLAAICLTLLTTINCLSVKVSMKVQDVFTVGKLLALIMIILSG 206
            :..::.          ..|| .:..|:....:..||....:...:.:.:|...|:|.:|..::..
Yeast   198 TVKYWT----------SVNA-DIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILA 251

  Fly   207 LYYMATGE-------LENFRNPWEGIYTARNIGYAFYSGLFAFGGWNYLNFVTEELQDPYKNLPR 264
            :.....|.       .|.:.||....:..:.:...|....|::||...|.....|.::|.|::|.
Yeast   252 IIINCGGAGDRRYIGAEYWHNPGPFAHGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPN 316

  Fly   265 AIWIAMPLVTSIYVLVNL--AYFAVVNKPEMLSS------------LAVAVTFGNRVFGPLAFMV 315
            |....:..:..||:|..:  .:....|..|:|.|            :||| :.|.:|       |
Yeast   317 ACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVA-SHGVKV-------V 373

  Fly   316 PIF----VALSTFGGVNGVLFTSARLFATGAQEGHLPKFFQLFHV-KQQTPI----PSLIFTCLM 371
            |.|    :.:|.....|..|::..||..:.|::|.|||.  |.:| :...|:    .||:|.|:.
Yeast   374 PHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKC--LAYVDRNGRPLLCFFVSLVFGCIG 436

  Fly   372 SLLMLLTDNVYQLINYFSSVLWLSVVASIAGM-LWL 406
              .:..:|...|:..      ||..::|::.: :|:
Yeast   437 --FVATSDAEEQVFT------WLLAISSLSQLFIWM 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-21NP_001245996.1 AA_permease_2 27..494 CDD:330980 96/422 (23%)
TAT1NP_009625.1 2A0310 91..567 CDD:273334 93/411 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2200
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.