DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-21 and SLC7A3

DIOPT Version :9

Sequence 1:NP_001245996.1 Gene:JhI-21 / 34624 FlyBaseID:FBgn0028425 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001041629.1 Gene:SLC7A3 / 84889 HGNCID:11061 Length:619 Species:Homo sapiens


Alignment Length:520 Identity:134/520 - (25%)
Similarity:207/520 - (39%) Gaps:133/520 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LKRKLTLINGVAIIVGTIIGSGIFIAPTGVFIYTESVGSSLLI-WLTCGILSTIGALCYAELGTC 100
            |.|.|:.::.||:.||:.:|:|:::....|  ..:..|.|::| :|...:.|.:..|||||.|..
Human    28 LARCLSTLDLVALGVGSTLGAGVYVLAGEV--AKDKAGPSIVICFLVAALSSVLAGLCYAEFGAR 90

  Fly   101 ITRSGGDYAYLLVSFGPLVGFLRLWIALLI-----------------------IRPTTQTIVALS 142
            :.|||..|.|..|:.|.|..|...|..:|.                       |..|.|..:||.
Human    91 VPRSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISKTLQGSIALH 155

  Fly   143 FAHYAVKPFFPECDPPQNAVKLLAAICLTLLTTINCLSVKVSMKVQDVFTVGKLLALIMIILSGL 207
            ..|...:  :|:         ..|...:.|||.:..|....|..|..|||...||.|..:::||.
Human   156 VPHVLAE--YPD---------FFALGLVLLLTGLLALGASESALVTKVFTGVNLLVLGFVMISGF 209

  Fly   208 --------------YYMATGELENFRN------------PWEGIYTARNIGYAFYSGLFAFGGWN 246
                          |.:|..||.:..:            .:|||  .|.....||    ||.|::
Human   210 VKGDVHNWKLTEEDYELAMAELNDTYSLGPLGSGGFVPFGFEGI--LRGAATCFY----AFVGFD 268

  Fly   247 YLNFVTEELQDPYKNLPRAIWIAMPLVTSIYVLVNLAYFAVVN-----------KPEMLSSLAVA 300
            .:....||.|:|.:::|      |.:|.|:.|.. ||||||.:           :||  |.|..|
Human   269 CIATTGEEAQNPQRSIP------MGIVISLSVCF-LAYFAVSSALTLMMPYYQLQPE--SPLPEA 324

  Fly   301 VTFGNRVFGPLAFMVPI--FVALSTFGGVNGVLFTSARLFATGAQEGHLPKFFQLFHVKQQTPI- 362
            ..:..  :.|..::|.:  ..||||  .:.|.:|...|:....|::|.|.:.....|...:||| 
Human   325 FLYIG--WAPARYVVAVGSLCALST--SLLGSMFPMPRVIYAMAEDGLLFRVLARIHTGTRTPII 385

  Fly   363 ---PSLIFTCLMSLLMLLTDNVYQLINYFS--SVLWLSVVASIAGMLWLRHKRPDLPRPIKVHLA 422
               .|.|....|:.|..|||    |::..|  ::|..|:| ||. :|.||: :||.    :....
Human   386 ATVVSGIIAAFMAFLFKLTD----LVDLMSIGTLLAYSLV-SIC-VLILRY-QPDQ----ETKTG 439

  Fly   423 LPITFMVSCVTLVLLPNLEEPQNLLIGIGITLAGIPFYYAFIARKKKPKCYGRLSNSVVEICRAI 487
            ..:......:|      .|..:..|.|:...|..||          .|     ||..:|.:|.::
Human   440 EEVELQEEAIT------TESEKLTLWGLFFPLNSIP----------TP-----LSGQIVYVCSSL 483

  Fly   488  487
            Human   484  483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-21NP_001245996.1 AA_permease_2 27..494 CDD:330980 134/520 (26%)
SLC7A3NP_001041629.1 2A0303 9..591 CDD:273330 134/520 (26%)
AA_permease_C 539..589 CDD:290617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.