DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-21 and SLC7A2

DIOPT Version :9

Sequence 1:NP_001245996.1 Gene:JhI-21 / 34624 FlyBaseID:FBgn0028425 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001158243.1 Gene:SLC7A2 / 6542 HGNCID:11060 Length:698 Species:Homo sapiens


Alignment Length:444 Identity:111/444 - (25%)
Similarity:193/444 - (43%) Gaps:95/444 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DGEEKIVLKRKLTLINGVAIIVGTIIGSGIFIAPTGVFIYTESVGSSLLIWLTCGILSTIGALCY 94
            |..|...|.|.|:.::.:|:.||:.:|:|:::. .|.....:|..|.::.:|...:.|.:..|||
Human    63 DSLEDTKLCRCLSTMDLIALGVGSTLGAGVYVL-AGEVAKADSGPSIVVSFLIAALASVMAGLCY 126

  Fly    95 AELGTCITRSGGDYAYLLVSFGPLVGFLRLWIALL--IIRPTT---------------------Q 136
            ||.|..:.::|..|.|..|:.|.|..|:..|..:|  :|..::                     :
Human   127 AEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLSKQIGQFLR 191

  Fly   137 TIVALSFAHYAVKP-FFPECDPPQNAVKLLAAICLTLLTT-INCLSVKVSMKVQDVFTVGKLLAL 199
            |...:::...|..| ||              |:||.||.. :....||.|..|..|||...:|.|
Human   192 TYFRMNYTGLAEYPDFF--------------AVCLILLLAGLLSFGVKESAWVNKVFTAVNILVL 242

  Fly   200 IMIILSGLYYMATGELENFRNPWE------------------GIYTARN-IGYAFYSGL------ 239
            :.::::|   ...|.:.|::...|                  .||.|.. :.|.|...|      
Human   243 LFVMVAG---FVKGNVANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC 304

  Fly   240 -FAFGGWNYLNFVTEELQDPYKNLPRAIWIAMPLVTSIYVLVNLAYFAV-----VNKPEML---- 294
             :||.|::.:....||:::|.|.:|      :.:|||:.|.. :|||.|     :..|..|    
Human   305 FYAFVGFDCIATTGEEVRNPQKAIP------IGIVTSLLVCF-MAYFGVSAALTLMMPYYLLDEK 362

  Fly   295 SSLAVAVTFGNRVFGPLAFMVPI--FVALSTFGGVNGVLFTSARLFATGAQEGHLPKFFQLFHVK 357
            |.|.||..:..  :||..::|..  ..||||  .:.|.:|...|:....|::|.|.|.....:.|
Human   363 SPLPVAFEYVG--WGPAKYVVAAGSLCALST--SLLGSIFPMPRVIYAMAEDGLLFKCLAQINSK 423

  Fly   358 QQTPIPSLIFTCLMSLLMLLTDNVYQLINYFS--SVLWLSVVASIAGMLWLRHK 409
            .:|||.:.:.:..::.||....::..|::..|  :::..|:||  |.:|.||::
Human   424 TKTPIIATLSSGAVAALMAFLFDLKALVDMMSIGTLMAYSLVA--ACVLILRYQ 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-21NP_001245996.1 AA_permease_2 27..494 CDD:330980 111/444 (25%)
SLC7A2NP_001158243.1 2A0303 45..648 CDD:273330 111/444 (25%)
AA_permease_C 596..646 CDD:290617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.