DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-21 and SLC7A14

DIOPT Version :9

Sequence 1:NP_001245996.1 Gene:JhI-21 / 34624 FlyBaseID:FBgn0028425 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_066000.2 Gene:SLC7A14 / 57709 HGNCID:29326 Length:771 Species:Homo sapiens


Alignment Length:506 Identity:110/506 - (21%)
Similarity:205/506 - (40%) Gaps:102/506 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLVEPTNGCAAPGNPNPADGEEKIVLKRKLTLINGVAIIVGTIIGSGIFIAPTGVFIYTESVGSS 76
            |::|.|....|.|..          |.:.||.::.:::.||:.:|:|:::. :|: :..|..|..
Human    34 SMLEGTGTTTAHGTK----------LAQVLTTVDLISLGVGSCVGTGMYVV-SGL-VAKEMAGPG 86

  Fly    77 LLI-WLTCGILSTIGALCYAELGTCITR-SGGDYAYLLVSFGPLVGFLRLW-IALLIIRPTTQTI 138
            ::: ::...:.|.:..:||||.|..:.: :|..|.|..|:.|..|.|...| :.|..:..|....
Human    87 VIVSFIIAAVASILSGVCYAEFGVRVPKTTGSAYTYSYVTVGEFVAFFIGWNLILEYLIGTAAGA 151

  Fly   139 VAL-----SFAHYAVKPFFPECDPPQNAV--------KLLAAICLTLLTTINCLSVKVSMKVQDV 190
            .||     |.|::.:..:..:.....|.:        .|||.:...::|.|..|.||.|:...:|
Human   152 SALSSMFDSLANHTISRWMADSVGTLNGLGKGEESYPDLLALLIAVIVTIIVALGVKNSIGFNNV 216

  Fly   191 FTVGKLLALIMIILSGLY-----YMATGELENFRNPWEGIYTARNIGYAFYSGLFAFGGWNYLNF 250
            ..|..|...:.|:::||:     |.|.|:.  ..:.|.|:  .:.....||    ||.|::.:..
Human   217 LNVLNLAVWVFIMIAGLFFINGKYWAEGQF--LPHGWSGV--LQGAATCFY----AFIGFDIIAT 273

  Fly   251 VTEELQDPYKNLPRAIWIAMPLVTSIYVLVN-----LAYFAVVNKPEMLSSLAVAVTFGNRVFGP 310
            ..||.::|..::|.||..::.:..:.||.|:     :..:..::....|..:.||..|       
Human   274 TGEEAKNPNTSIPYAITASLVICLTAYVSVSVILTLMVPYYTIDTESPLMEMFVAHGF------- 331

  Fly   311 LAFMVPIFVALSTFGGVN----GVLFTSARLFATGAQEGHLPKFFQLFHVKQQTPIPSLIFTCLM 371
              :.....||:.:..|:.    |.||...|:....|.:|.|.:|  |.||...|..|  :..|::
Human   332 --YAAKFVVAIGSVAGLTVSLLGSLFPMPRVIYAMAGDGLLFRF--LAHVSSYTETP--VVACIV 390

  Fly   372 SLLMLLTDNVYQLINYFSSVLWLSVVASIAGMLWLRHKRPDLPRPIKVHLALPITFMVSCVTLVL 436
            |                         ..:|.:|.|.....||...:.:...|..|.:..||.|:.
Human   391 S-------------------------GFLAALLALLVSLRDLIEMMSIGTLLAYTLVSVCVLLLR 430

  Fly   437 LPNLEEPQNLLIGIGITLAGIPFYYAFIARKKKPKCYGRLSNSVVEICRAI 487
            .    :|::.:.|          :..|::.:...|..|.|::...|.|..:
Human   431 Y----QPESDIDG----------FVKFLSEEHTKKKEGILADCEKEACSPV 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-21NP_001245996.1 AA_permease_2 27..494 CDD:330980 105/491 (21%)
SLC7A14NP_066000.2 2A0303 48..677 CDD:273330 105/492 (21%)
AA_permease_C 627..677 CDD:290617
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 736..771
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2200
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.