DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-21 and Slc7a14

DIOPT Version :9

Sequence 1:NP_001245996.1 Gene:JhI-21 / 34624 FlyBaseID:FBgn0028425 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001128087.1 Gene:Slc7a14 / 499587 RGDID:1594375 Length:412 Species:Rattus norvegicus


Alignment Length:158 Identity:29/158 - (18%)
Similarity:52/158 - (32%) Gaps:53/158 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 WIAMPLVTSIYVLVNLAYFAVVNKPEMLSSLAVAVTFGNRVFGPLAFMVPIFVALSTFGGVNGVL 331
            |.|:.||..:.:|:.:..|.::.:||....|.        ...|....||.|..|     ||   
  Rat   236 WWAILLVVLMLLLITVLVFVILQQPENPKKLP--------YMAPCLPFVPAFAML-----VN--- 284

  Fly   332 FTSARLFATGAQEGHLPKFFQLFHVKQQTPIPSLIFT--CLMSLLMLLTDNVYQLINYFSSVLW- 393
                                 ::.:.:.:.|..:.|.  |.:.:|:           ||...:| 
  Rat   285 ---------------------IYLMLKLSTITWIRFAVWCFVGMLI-----------YFGYGIWN 317

  Fly   394 --LSVVASIAGMLWLRHKRPDLPRPIKV 419
              |.:.|....:....::|.|:..|..|
  Rat   318 STLEISAREQALHQSTYQRYDVDDPFSV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-21NP_001245996.1 AA_permease_2 27..494 CDD:330980 29/158 (18%)
Slc7a14NP_001128087.1 AA_permease_C 268..318 CDD:290617 14/89 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.