DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-21 and tadr

DIOPT Version :9

Sequence 1:NP_001245996.1 Gene:JhI-21 / 34624 FlyBaseID:FBgn0028425 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_724308.2 Gene:tadr / 35370 FlyBaseID:FBgn0032911 Length:719 Species:Drosophila melanogaster


Alignment Length:268 Identity:50/268 - (18%)
Similarity:84/268 - (31%) Gaps:94/268 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVEPTNGC------------AAPGNPNPADGE------------------------EKI------ 35
            |.|||:.|            .:.|.|.|:|.|                        |||      
  Fly   443 LGEPTSPCPQREGRDVESTILSDGEPPPSDFEYPDKFDKSDSDTSTDIDAIVDEYREKIKVTTAG 507

  Fly    36 VLKRKLTLIN----GVAIIVGTIIGSGIFIAPTGVFIYTESVGSSLLIWLTCGILSTIGALCYAE 96
            .|:|.:.:..    .|.|....:||.||.:...|:.::          |....:...||.|....
  Fly   508 PLERSVRVPTVSSWRVTIFAIVVIGLGIALCIAGLMMH----------WAPAALTGGIGVLIVTI 562

  Fly    97 LGTCITRSGGDYAYLLVSFGPLVGFLRLWIALLIIRPTTQTIVALSFAHYAVKPFFPECDPPQNA 161
            :...|.:    |...:::..|::..:.|.:.:::            |:..|:..:      |...
  Fly   563 MMGFIPK----YTGSVINVSPVICGMSLLMGVIL------------FSGCAIHSW------PGLL 605

  Fly   162 VKLLAAICLTLLT---TINCLSVKVSMKVQDVFTVGKLLALIMIILSGLYYM--ATGELENFRNP 221
            :.|:|.:.|.:..   ..||......|..|.:.:|           ||...|  |:|...|...|
  Fly   606 IWLMAGLILVIRCDKYCCNCFEHTTIMNAQLIPSV-----------SGKSNMGSASGSASNLAGP 659

  Fly   222 WEGIYTAR 229
            ...|...|
  Fly   660 STSIRIPR 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-21NP_001245996.1 AA_permease_2 27..494 CDD:330980 43/242 (18%)
tadrNP_724308.2 2A0303 5..>209 CDD:273330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.