DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-21 and CG12531

DIOPT Version :9

Sequence 1:NP_001245996.1 Gene:JhI-21 / 34624 FlyBaseID:FBgn0028425 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_608350.2 Gene:CG12531 / 32986 FlyBaseID:FBgn0031064 Length:812 Species:Drosophila melanogaster


Alignment Length:450 Identity:99/450 - (22%)
Similarity:183/450 - (40%) Gaps:92/450 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GNPNPADGEEKIVLKRKLTLINGVAIIVGTIIGSGIFIAPTGVFIYTESVGSSLLI-WLTCGILS 87
            ||..|    :|..|.:.|..::..::.:|:..|:|:::. .|: :..:..|..::| ::...|.|
  Fly    44 GNAQP----QKPKLTKCLNTLDLTSLGIGSCCGTGMYLV-AGM-VAQKIAGPGVIISFIIAAIAS 102

  Fly    88 TIGALCYAELGTCITR-SGGDYAYLLVSFGPLVGFLRLWIALLIIRPTTQTIVALSFAHYAVKPF 151
            .....||||.|..:.. ||..|.|..|:.|..|.|:..|..:|      :.::..|....|:...
  Fly   103 IFSGACYAEFGVRVPHTSGSAYMYSYVAVGEFVAFIIGWNMIL------EYLIGTSACACALSSS 161

  Fly   152 FPEC------------------DPPQNAVKLLAAICLTLL-TTINCLSVKVSMKVQDVFTVGKLL 197
            |...                  .||.     ..|..:||| |.:..:....|:..........|.
  Fly   162 FDSLTGNAIARTISESIGTIFGKPPD-----FIAFGITLLMTCVLAMGASKSVIFNHSLNAVNLA 221

  Fly   198 ALIMIILSGLYYMAT---GELENFRNP--WEGIYTARNIGYAFYSGLFAFGGWNYLNFVTEELQD 257
            ..:.::.:||:|:.|   .|.:.|. |  |.|:::  .....||    ||.|::.:....||..:
  Fly   222 TWVFVMAAGLFYVDTKTWSEHQGFL-PYGWSGVFS--GAATCFY----AFIGFDIIATTGEEAHN 279

  Fly   258 PYKNLPRAIWIAMPLVTSIYVLVNLA------------------YFAVVNKPEMLSSLAVAVTFG 304
            |.|::|:||..::.:|...||.|:|.                  .::.||.|:..:.:|:..|.|
  Fly   280 PQKSIPKAIVGSLVVVLIAYVSVSLVLTLVVPYDHINTGAALVQMWSYVNAPKCRAVVAIGATAG 344

  Fly   305 NRVFGPLAFMVPIFVALSTFGGVNGVLFTSARLFATGAQEGHLPKFFQLFHVKQQTPIPSL--IF 367
                          ::::.||.    :|...|:....||:|.:  |.||..:..:|.:|.|  |.
  Fly   345 --------------LSVAMFGS----MFPMPRVIYAMAQDGLI--FRQLSQLWHRTNVPGLATIG 389

  Fly   368 TCLMSLLMLLTDNVYQLINYFS--SVLWLSVVASIAGMLWLRHKRPDLPRPIKVHLALPI 425
            :.|.:.|:.||..:..|:...|  ::|..::|::...:|..:.....|...:...|..|:
  Fly   390 SGLAAALVALTVRLEILVEMMSIGTLLAYTLVSTCVLVLRYQPHSTSLVELLPAQLRTPV 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-21NP_001245996.1 AA_permease_2 27..494 CDD:330980 97/446 (22%)
CG12531NP_608350.2 2A0303 52..679 CDD:273330 95/437 (22%)
AA_permease_C 629..679 CDD:290617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2200
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.