DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-21 and Slc7a3

DIOPT Version :9

Sequence 1:NP_001245996.1 Gene:JhI-21 / 34624 FlyBaseID:FBgn0028425 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_058913.1 Gene:Slc7a3 / 29485 RGDID:68342 Length:619 Species:Rattus norvegicus


Alignment Length:454 Identity:122/454 - (26%)
Similarity:186/454 - (40%) Gaps:116/454 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GEEKIVLKRKLTLINGVAIIVGTIIGSGIFIAPTGVFIYTESVGSSLLI-WLTCGILSTIGALCY 94
            ||.:  |.|.|:.::.||:.||:.:|:|:::....|  ..|..|.|::| :|...:.|.:..|||
  Rat    24 GETR--LARCLSTLDLVALGVGSTLGAGVYVLAGEV--AKEKAGPSIVICFLVAALSSVLAGLCY 84

  Fly    95 AELGTCITRSGGDYAYLLVSFGPLVGFLRLWIALLI-----------------------IRPTTQ 136
            ||.|..:..||..|.|..|:.|.|..|...|..:|.                       |..|.:
  Rat    85 AEFGARVPGSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISQTLK 149

  Fly   137 TIVALSFAHYAVKPFFPECDPPQNAVKLLAAICLTLLTTINCLSVKVSMKVQDVFTVGKLLALIM 201
            ..:.|:..|...:  :|:         ..|...:.|||.:..|....|..|..|||...||.|..
  Rat   150 GTILLNMPHVLAE--YPD---------FFALALVLLLTGLLVLGANESGLVTKVFTGMNLLVLGF 203

  Fly   202 IILSGLYYMATGELENFR---------------------------NPW--EGIYTARNIGYAFYS 237
            :|:||   ...|||.|::                           .|:  |||  .|.....|| 
  Rat   204 VIISG---FIKGELRNWKLTKEDYCLTMSESNGTCSLDSMGSGGFMPFGLEGI--LRGAATCFY- 262

  Fly   238 GLFAFGGWNYLNFVTEELQDPYKNLPRAIWIAMPLVTSIYVLVNLAYFAVVN-----------KP 291
               ||.|::.:....||.|:|.:::|..|.|::.:..       ||||.|.:           :|
  Rat   263 ---AFVGFDCIATTGEEAQNPQRSIPMGIVISLSICF-------LAYFGVSSALTLMMPYYKLQP 317

  Fly   292 EMLSSLAVAVTFGNRVFGPLAFMVPI--FVALSTFGGVNGVLFTSARLFATGAQEGHLPKFFQLF 354
            |  |.|..|.|:..  :.|..::|.|  ..||||  .:.|.:|...|:....|::|.|.:.....
  Rat   318 E--SPLPEAFTYVG--WEPARYLVAIGSLCALST--SLLGSMFPMPRVIYAMAEDGLLFRVLARV 376

  Fly   355 HVKQQTPI----PSLIFTCLMSLLMLLTDNVYQLINYFS--SVLWLSVVASIAGMLWLRHKRPD 412
            |....|||    .|.:....|:.|..|||    |::..|  ::|..|:| ||. :|.||: :||
  Rat   377 HNGTHTPIVATVVSGVIAAFMAFLFELTD----LVDLMSIGTLLAYSLV-SIC-VLILRY-QPD 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-21NP_001245996.1 AA_permease_2 27..494 CDD:330980 122/454 (27%)
Slc7a3NP_058913.1 2A0303 4..591 CDD:273330 122/454 (27%)
AA_permease_C <551..589 CDD:290617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.