DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JhI-21 and Slc7a3

DIOPT Version :9

Sequence 1:NP_001245996.1 Gene:JhI-21 / 34624 FlyBaseID:FBgn0028425 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001288769.1 Gene:Slc7a3 / 11989 MGIID:1100521 Length:618 Species:Mus musculus


Alignment Length:455 Identity:121/455 - (26%)
Similarity:184/455 - (40%) Gaps:118/455 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GEEKIVLKRKLTLINGVAIIVGTIIGSGIFIAPTGVFIYTESVGSSLLI-WLTCGILSTIGALCY 94
            ||.:  |.|.|:.::.||:.||:.:|:|:::....|  ..:..|.|::| :|...:.|.:..|||
Mouse    24 GETR--LARCLSTLDLVALGVGSTLGAGVYVLAGEV--AKDKAGPSIVICFLVAALSSVLAGLCY 84

  Fly    95 AELGTCITRSGGDYAYLLVSFGPLVGFLRLWIALLI-----------------------IRPTTQ 136
            ||.|..:..||..|.|..|:.|.|..|...|..:|.                       |..|.:
Mouse    85 AEFGARVPGSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISRTLK 149

  Fly   137 TIVALSFAHYAVKPFFPECDPPQNAVKLLAAICLTLLTTINCLSVKVSMKVQDVFTVGKLLALIM 201
            ..:.|...|...:  :|:         ..|...:.|||.:..|....|..|..|||...||.|..
Mouse   150 GTILLKMPHVLAE--YPD---------FFALALVLLLTGLLVLGASKSALVTKVFTGMNLLVLSF 203

  Fly   202 IILSGLYYMATGELENFR---------------------------NPW--EGIYTARNIGYAFYS 237
            :|:||   ...|||.|::                           .|:  |||  .|.....|| 
Mouse   204 VIISG---FIKGELRNWKLTKEDYCLTMSESNGTCSLDSMGSGGFMPFGLEGI--LRGAATCFY- 262

  Fly   238 GLFAFGGWNYLNFVTEELQDPYKNLPRAIWIAMPLVTSIYVLVNLAYFAVVN-----------KP 291
               ||.|::.:....||.|:|.:::|      |.:|.|:::.. ||||.|.:           .|
Mouse   263 ---AFVGFDCIATTGEEAQNPQRSIP------MGIVISMFICF-LAYFGVSSALTLMMPYYKLHP 317

  Fly   292 EMLSSLAVAVTFGNRVFGPLAFMVPI--FVALSTFGGVNGVLFTSARLFATGAQEGHLPKFFQLF 354
            |  |.|..|.::..  :.|..::|.|  ..||||  .:.|.:|...|:..:.|::|.|  |..|.
Mouse   318 E--SPLPEAFSYVG--WEPARYLVAIGSLCALST--SLLGSMFPMPRVMYSMAEDGLL--FRVLA 374

  Fly   355 HVKQQTPIP------SLIFTCLMSLLMLLTDNVYQLINYFS-SVLWLSVVASIAGMLWLRHKRPD 412
            .|...|.||      |.:....|:.|..|||    |::..| ..|....:.||. :|.||: :||
Mouse   375 KVHSVTHIPIVATLVSGVIAAFMAFLFELTD----LVDLMSIGTLLAHSLVSIC-VLILRY-QPD 433

  Fly   413  412
            Mouse   434  433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JhI-21NP_001245996.1 AA_permease_2 27..494 CDD:330980 121/455 (27%)
Slc7a3NP_001288769.1 2A0303 4..588 CDD:273330 121/455 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.