DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and AT4G38690

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_195581.1 Gene:AT4G38690 / 830025 AraportID:AT4G38690 Length:318 Species:Arabidopsis thaliana


Alignment Length:171 Identity:48/171 - (28%)
Similarity:73/171 - (42%) Gaps:43/171 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 LAKTCLKVFP----------RWMNDLKSKIG--EMRLRDLFIPGTHDSGSYRPNFDPLLRESLVT 238
            |.|:|...||          .||    :.:|  ::.:..:..||||||.:.:.....:.|     
plant    25 LEKSCGCEFPGCDYMPSDRKNWM----AGVGPEKLHINKIVWPGTHDSATNKIGIRFVSR----- 80

  Fly   239 KYALTQDDDIRGQLMHGVRYLDIRVGYYRNSPDPFFIYHGITKQRPLQEVINQVRDFVYET-NEI 302
            .:|..|...|..||:.|.|.|||||...|.      :.|||.|...:..|:..::.|:.|| :||
plant    81 PFAKCQSLSIYNQLVAGTRVLDIRVQEDRR------VCHGILKTYSVDVVLADLKRFLSETESEI 139

  Fly   303 IIFGLK-----EFPVGFGKGLGVHRLLISYLRDQLKDLIAH 338
            :|..::     |.|..|.|          ||.:||.:.:.|
plant   140 VILEIRTEFGHEDPPEFDK----------YLVEQLGEHLIH 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 41/145 (28%)
AT4G38690NP_195581.1 PI-PLCXDc_plant 33..313 CDD:176556 45/163 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2671
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.