DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and AT4G34930

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_195219.1 Gene:AT4G34930 / 829645 AraportID:AT4G34930 Length:391 Species:Arabidopsis thaliana


Alignment Length:288 Identity:76/288 - (26%)
Similarity:116/288 - (40%) Gaps:52/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WMNDLKSKIGEMRLRDLFIPGTHDSGSYRPNFDPLLRESLVTKY-ALTQDDDIRGQLMHGVRYLD 260
            ||..|  .:.::.|..:..||||||.:..      :.:.|||:: ...|...|..||:.|.|.||
plant   113 WMAHL--SVDKLTLNKIVWPGTHDSATNG------IGDPLVTRWLGECQTLSIFDQLVLGTRVLD 169

  Fly   261 IRVGYYRNSPDPFFIYHGITKQRPLQEVINQVRDFVYET-NEIII------FGLKEFPVGFGKGL 318
            ||....|      .:.||......:..|:|.|..||.|| :||||      ||.|: |..|.   
plant   170 IRFQEDR------CVCHGALSSYNVDVVLNDVIRFVSETQSEIIILEIRTEFGKKD-PFEFE--- 224

  Fly   319 GVHRLLISYLRDQLKDLIAH-PSLTWGASLRDIWARRQNVFLAYDHEAMVEEFPDVLFGS--VEQ 380
                   :||.|:|...:.| ....:...:.:|..:|. :.:....|:.......:|:.|  ::.
plant   225 -------TYLVDKLGQFLIHQDDNLFNKPVSEILPKRV-ICIWKPRESPKPSRGGILWNSDYLKD 281

  Fly   381 RW-GNKQTWDQLETYLRNVNDFDVSRFSSRPVSDMAELT-------PETWDVILDKTGGLRKMAD 437
            .| .....|.:.::.|::::  :....|||......|.|       |..|  :...|..:||.| 
plant   282 NWIDTDLPWTKFQSNLKHLS--EQQPISSRKFFYRVENTVTPQADNPVVW--VKQVTDRIRKHA- 341

  Fly   438 NVNWRISQLYRNELGTNANIVSADFIRG 465
              ...|||......|....|:|.|||.|
plant   342 --RLFISQCASKGYGDKLQILSTDFIEG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 73/283 (26%)
AT4G34930NP_195219.1 PI-PLCc_GDPD_SF 100..380 CDD:301322 76/288 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4634
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2671
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.