DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and plcxd2

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_688423.2 Gene:plcxd2 / 559936 ZFINID:ZDB-GENE-091204-217 Length:320 Species:Danio rerio


Alignment Length:310 Identity:75/310 - (24%)
Similarity:132/310 - (42%) Gaps:43/310 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WMNDLKSKIGEMRLRDLFIPGTHDSGSY----RPNFDP--------------LLRESLVTKYALT 243
            ||..|...:..|.|:.|.:||:|||.|:    :....|              .|.:.::.|:::|
Zfish    14 WMGSLCPALTSMPLKHLAVPGSHDSFSFWVDEQAPVGPDQKAYVKHLAAIFRFLAKKVMKKWSMT 78

  Fly   244 QDDDIRGQLMHGVRYLDIRVGYYRNSP-----DPFFIYHGITKQRPLQEVINQVRDFVYETNEII 303
            |:...|.||..|:||.|:||.   :.|     :.:|| ||:...: :::.:|.:.:|:....:.:
Zfish    79 QNLTFREQLEGGIRYFDLRVS---SKPGEAGHEIYFI-HGLFGHK-VRDGLNDINNFLNIHKKEV 138

  Fly   304 IFGLKEFPVGFGKGLGVHRLLISYLRDQLKDLIAHPSLTWGASLRDIWARRQNVFLAYDHEAMVE 368
            :|  .:|...:..|...||.||..|:|.....:....:....:|..:|..|..|.:.|.|.: .|
Zfish   139 VF--LDFNHHYAMGEEHHRYLIKMLQDVFGHKLCRIDVVEEITLNYLWENRYQVLVFYHHPS-AE 200

  Fly   369 EFPDVLFGS-VEQRWGNKQTWDQLETYLRNVNDFDVSRFSSRPVSDMAELTPETWDVILDKTGGL 432
            ..|.:..|| :...|.|.....:|..:|..... :.:::.|..|| .|.|||....:......||
Zfish   201 GCPVMWPGSKIPAPWANTTDTTKLIQFLETTLG-ERAKYGSFHVS-QAILTPRVKTIARGLVQGL 263

  Fly   433 ------RKMADNVNWRISQLYRNELGTNANIVSADFIRGTTLVETAIEYN 476
                  |.:...:.|..:|....:   ..||:::||:.......|.|:.|
Zfish   264 RNYLVERNLPTIMTWVEAQKPGKD---GVNIITSDFVELVDFANTVIKLN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 72/305 (24%)
plcxd2XP_688423.2 PI-PLCXD1c 18..310 CDD:176555 72/304 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.