DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and zgc:112023

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001017673.1 Gene:zgc:112023 / 550368 ZFINID:ZDB-GENE-050417-162 Length:309 Species:Danio rerio


Alignment Length:301 Identity:78/301 - (25%)
Similarity:125/301 - (41%) Gaps:54/301 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WMNDLKSKIGEMRLRDLFIPGTHDSGSY------------------RPNFDPLLRESLVTKYALT 243
            ||:.:.|.:.::.|.:|.|||:|||.:|                  ...:.|.:....:.|:|.|
Zfish    10 WMSKMPSHMWDIPLWNLAIPGSHDSMTYCLDKQSSVSNSTPRVVQVLDKYFPCIVRPCIMKWATT 74

  Fly   244 QDDDIRGQLMHGVRYLDIRVGYYRNSPDP-FFIYHGI----TKQRPLQEVINQVRDFVYETNEII 303
            |:..|..||..|:|:||:|:.:....||. |:..||:    |.:..|.||:..:...:   .|::
Zfish    75 QEGAISNQLDLGIRFLDLRIAHKIKDPDEVFYFAHGVYSLLTVKEALTEVVRWLDQHI---KEVV 136

  Fly   304 IFGLKEFPVGFGKGLGVHRLLISYLRDQLKDLIAHPSLTWGASLRDIWARRQNVFLAYDHEA--- 365
            |..|..|.   |..|..|:.||.:|.......|...|:|  .||::.|.....|.|:||.|:   
Zfish   137 IIALSNFE---GMNLDQHKDLIQFLIATFNKKICPKSVT--PSLQECWNHSYQVILSYDDESSTG 196

  Fly   366 MVEEFPDVLFGSVEQRWGNKQTWDQLETYLRNVNDFDVSRFSSRPVSDMA---ELTPETWDVILD 427
            .||.:|...:.     |.||...:.:.:||.:      .:...||....|   .||.:...|:..
Zfish   197 YVELWPQCPYW-----WANKSDPNLVISYLED------QKNEGRPSQFFAAGLNLTEDARYVLCH 250

  Fly   428 KTGGLRKMADN-----VNWRISQLYRNELGTNANIVSADFI 463
            ....|:.|...     :.| :.|..........||:.|||:
Zfish   251 PCQSLQSMTRRSYSLLMKW-VKQQRPGSGQACLNIICADFV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 76/296 (26%)
zgc:112023NP_001017673.1 PI-PLCXD1c 14..305 CDD:176555 76/297 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243732at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.