DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and Plcxd2

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001127952.1 Gene:Plcxd2 / 433022 MGIID:3647874 Length:340 Species:Mus musculus


Alignment Length:312 Identity:76/312 - (24%)
Similarity:131/312 - (41%) Gaps:49/312 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WMNDLKSKIGEMRLRDLFIPGTHDSGSY----RPNFDP--------LLRESLV----TKYALTQD 245
            ||..|.:.:..:.|.:|.|||:|||.||    :....|        |.|.|||    .|:::||:
Mouse    35 WMASLPAHLHNVPLSNLAIPGSHDSFSYWVDEKSPVGPDQTQAVIRLARISLVKKLMKKWSVTQN 99

  Fly   246 DDIRGQLMHGVRYLDIRVGYYRNSPDP--FFIYHGITKQRPLQEVINQVRDFVYETNEIIIFGLK 308
            ...|.||..|:||.|:||.......|.  :|| ||:...: :.:.:.::..|:.:..:.|||  .
Mouse   100 LTFREQLEAGIRYFDLRVSSKPGDTDQEIYFI-HGLFGIK-VWDGLMEIDAFLTQHPQEIIF--L 160

  Fly   309 EFPVGFGKGLGVHRLLISYLRDQLKDLIAHPSLTWGASLRDIWARRQNVFLAYDHEAMVEEFPDV 373
            :|...:......|:.|:..:::...:.:.........:||.:|.::..|.:.| |....:::|.:
Mouse   161 DFNHFYAMDESHHKCLVLRIQEAFGNKLCPACSVESMTLRSLWEKKYQVLIFY-HCPFYKQYPFL 224

  Fly   374 LFG-SVEQRWGNKQTWDQLETYLRNV-------NDFDVSRFSSRPVSDMAELTPETWDVILDKTG 430
            ..| .:...|.|..:..:|..:|...       ..|.||:         |.|||....:.....|
Mouse   225 WPGKKIPAPWANTTSVQKLILFLETTLSERAPRGAFHVSQ---------AILTPRVKTIARGLVG 280

  Fly   431 GL------RKMADNVNWRISQLYRNELGTNANIVSADFIRGTTLVETAIEYN 476
            ||      |.:...::|..:|   .......||:::||:.......|.||.|
Mouse   281 GLKNTLVHRNLPAILDWVKTQ---KPGAMGVNIITSDFVDLIDFATTVIELN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 73/307 (24%)
Plcxd2NP_001127952.1 PI-PLCXD1c 39..329 CDD:176555 73/306 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.