DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and Plcxd2

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001127953.1 Gene:Plcxd2 / 363781 RGDID:1563504 Length:340 Species:Rattus norvegicus


Alignment Length:312 Identity:76/312 - (24%)
Similarity:130/312 - (41%) Gaps:49/312 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WMNDLKSKIGEMRLRDLFIPGTHDSGSY----RPNFDP--------LLRESLV----TKYALTQD 245
            ||..|...:..:.|.:|.|||:|||.||    :....|        |.|.|||    .|:::||:
  Rat    35 WMASLPPHLHNVPLSNLAIPGSHDSFSYWVDEKSPVGPDQTQAVKRLARISLVKKLMKKWSVTQN 99

  Fly   246 DDIRGQLMHGVRYLDIRVGYYRNSPDP--FFIYHGITKQRPLQEVINQVRDFVYETNEIIIFGLK 308
            ...|.||..|:||.|:||.......|.  :|| ||:...: :.:.:.::..|:.:..:.|||  .
  Rat   100 LTFREQLEAGIRYFDLRVSSKPGDTDQEIYFI-HGLFGIK-VWDGLMEIDAFLTQHPQEIIF--L 160

  Fly   309 EFPVGFGKGLGVHRLLISYLRDQLKDLIAHPSLTWGASLRDIWARRQNVFLAYDHEAMVEEFPDV 373
            :|...:......|:.|:..:::...:.:.........:||.:|.::..|.:.| |....:::|.:
  Rat   161 DFNHFYAMDEAHHKCLVLRIQEAFGNKLCPACSVESMTLRTLWEKKYQVLIFY-HCPFYKQYPFL 224

  Fly   374 LFG-SVEQRWGNKQTWDQLETYLRNV-------NDFDVSRFSSRPVSDMAELTPETWDVILDKTG 430
            ..| .:...|.|..:..:|..:|...       ..|.||:         |.|||....:.....|
  Rat   225 WPGKKIPAPWANTTSVQKLILFLETTLSERAPRGAFHVSQ---------AILTPRVKTIARGLVG 280

  Fly   431 GL------RKMADNVNWRISQLYRNELGTNANIVSADFIRGTTLVETAIEYN 476
            ||      |.:...::|..:|   .......||:::||:.......|.||.|
  Rat   281 GLKNTLVHRNLPAILDWVKTQ---KPGAMGVNIITSDFVDLIDFATTVIELN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 73/307 (24%)
Plcxd2NP_001127953.1 PI-PLCXD1c 39..329 CDD:176555 73/306 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.