DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and CG10747

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster


Alignment Length:320 Identity:71/320 - (22%)
Similarity:136/320 - (42%) Gaps:59/320 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WMNDLKSKIGEMRLRDLFIPGTHDSGSY--------RPNFDPLLRE------SLVTKYALTQDDD 247
            ||.||.|::.::.:.:|.|||:|:|.:|        .|:.:..:|.      ..|.:::.||...
  Fly     6 WMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHRFFPCFVRRWSKTQSSG 70

  Fly   248 IRGQLMHGVRYLDIRVGYYRNSPDPFFIYHGITKQRPLQEVINQVRDFVYETN--EIIIFGLKEF 310
            ...||..||||.|:|:.   ...|.|:..||:.... :.|.:.::|.|| :|:  |::|..|:.|
  Fly    71 TLDQLELGVRYFDLRIA---QKDDKFYYCHGLFAME-IFEPLLEIRQFV-DTHPEEVVILDLQHF 130

  Fly   311 PVGFGKGLGVHRLLISYLRDQLKDLI---AHPSL-TWGASLRDIWARR-----QNVFLAYDH--- 363
                      :.:.:::.:...||||   ||... |...||:|....|     ::|.:.|..   
  Fly   131 ----------YAMTVAHHQKLHKDLIQFFAHRLYSTVDGSLKDCTLNRCLEMQRSVVIIYRRCPI 185

  Fly   364 EAMVEEFPDVLFGSVEQRWGNKQTWDQLETYLRNVNDFDVSRFSSRPVSDMAELTPETWDVILDK 428
            ...:..:|...:.:   .|.||.:..:|:::|   .|..:||...:.......:||....:....
  Fly   186 PLPLRFWPSYAWPT---PWPNKASVKKLQSFL---EDSLLSRQPQQGYVSQCLITPTGRYIAFRL 244

  Fly   429 TGGLRKMADNVNWRISQLYRNEL--------GTNANIVSADFI--RGTTLVETAIEYNAR 478
            ...|:..|..|:.::....:.::        ....|:..|||:  :|....:..::.|.:
  Fly   245 FFTLKSTAKRVDKKLQPWIQEQIPGPFEPKDEPRVNVFLADFVSLKGGQFCDWVVDLNTK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 67/315 (21%)
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 67/312 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5735
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.