DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and PLCXD2

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001172035.1 Gene:PLCXD2 / 257068 HGNCID:26462 Length:305 Species:Homo sapiens


Alignment Length:265 Identity:69/265 - (26%)
Similarity:115/265 - (43%) Gaps:27/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WMNDLKSKIGEMRLRDLFIPGTHDSGSY----RPNFDP--------LLRESLV----TKYALTQD 245
            ||..|...:..:.|.:|.|||:|||.||    :....|        |.|.|||    .|:::||:
Human    35 WMASLPPHLHNLPLSNLAIPGSHDSFSYWVDEKSPVGPDQTQAIKRLARISLVKKLMKKWSVTQN 99

  Fly   246 DDIRGQLMHGVRYLDIRVGYYRNSPDP--FFIYHGITKQRPLQEVINQVRDFVYETNEIIIFGLK 308
            ...|.||..|:||.|:||.......|.  :|| ||:...: :.:.:.::..|:.:..:.|||  .
Human   100 LTFREQLEAGIRYFDLRVSSKPGDADQEIYFI-HGLFGIK-VWDGLMEIDSFLTQHPQEIIF--L 160

  Fly   309 EFPVGFGKGLGVHRLLISYLRDQLKDLIAHPSLTWGASLRDIWARRQNVFLAYDHEAMVEEFPDV 373
            :|...:......|:.|:..:::...:.:.........:||.:|.:...|.:.| |....:::|.:
Human   161 DFNHFYAMDETHHKCLVLRIQEAFGNKLCPACSVESLTLRTLWEKNCQVLIFY-HCPFYKQYPFL 224

  Fly   374 LFG-SVEQRWGNKQTWDQLETYLRNVNDFDVSRFSSRPVSDMAELTPETWDVILDKTGGLRKMAD 437
            ..| .:...|.|..:..:|..:|........|| .|..|| .|.|||....:.....|||:....
Human   225 WPGKKIPAPWANTTSVRKLILFLETTLSERASR-GSFHVS-QAILTPRVKTIARGLVGGLKNTLV 287

  Fly   438 NVN-W 441
            :.| |
Human   288 HSNRW 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 66/260 (25%)
PLCXD2NP_001172035.1 PI-PLCXD1c 39..291 CDD:176555 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.