DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and si:dkey-66a8.7

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_021332868.1 Gene:si:dkey-66a8.7 / 101885746 ZFINID:ZDB-GENE-131127-421 Length:323 Species:Danio rerio


Alignment Length:334 Identity:77/334 - (23%)
Similarity:131/334 - (39%) Gaps:77/334 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WMNDLKSKIGEMRLRDLFIP-----------GTHDSGSYRPNFD-PLLRES-------------- 235
            ||:.|..|:.::.|.:|.||           |:||:.||..:.: ||||..              
Zfish    13 WMSRLPEKLLDIPLTNLAIPGETMKTIGESKGSHDAMSYCLDINSPLLRSESDTFRLLDGVFYCF 77

  Fly   236 ---LVTKYALTQDDDIRGQLMHGVRYLDIRVGY--YRNSPDPFFIYHGITKQRPLQEVINQVRDF 295
               .:.::|.||..:|..||..|:||.|:||.:  |..|.:.:|. |.|.....:.|.:..|..:
Zfish    78 TRPFIYRWATTQVINIVEQLQAGIRYFDLRVAHKQYDTSSELYFT-HIIYTHATVIETLETVNLW 141

  Fly   296 V-YETNEIIIFGLKEFPVGFGKGLGVHRLLISYLRDQLKDLIAHPSLTWGASLRDIWARRQNVFL 359
            : ....||||...:.|.   |....:|...|..|::..:..:...:.|. .:||.:||....|.|
Zfish   142 LESHPKEIIILACRNFE---GMSDELHEGFIYALKNIFRSKLCPVNETL-VTLRRLWALGCQVVL 202

  Fly   360 AY-DHEAMVEEFPDVLFGSVEQRWGNKQTWDQLETYLR----------------NVNDFDVSRFS 407
            :| |.::.:..  ..|:.:::..|.||...::|..|:.                |:.. |....:
Zfish   203 SYEDPQSTIRH--KELWPAIQYLWANKPNAEELIQYMECKKQLGRPEGFFVAGLNLTT-DRCFIA 264

  Fly   408 SRPVSDMAELTPETWDVILDKTGGLRKMADNVNWRISQLYRNELGTN---ANIVSADFIRGTTLV 469
            |.|...:..||.:.|:.:.:             |    |...:.|..   .||::.|||....:.
Zfish   265 SNPQESLKTLTKKYWNRVQE-------------W----LKEQKPGAEPPCLNIIAGDFIGLLPIC 312

  Fly   470 ETAIEYNAR 478
            ...|..|.:
Zfish   313 SLVISLNKK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 74/329 (22%)
si:dkey-66a8.7XP_021332868.1 PI-PLCXD1c 17..319 CDD:176555 74/326 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243732at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.