DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and LOC100151335

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_001923476.1 Gene:LOC100151335 / 100151335 -ID:- Length:302 Species:Danio rerio


Alignment Length:317 Identity:69/317 - (21%)
Similarity:128/317 - (40%) Gaps:59/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WMNDLKSKIGEMRLRDLFIPGTHDSGSYRPNFD-PLLR---------------ESLVTKYALTQD 245
            ||:.|......:.|..:.|||:||:.:|..:.| |:|.               ..:|.|:...||
Zfish    10 WMSKLNETFTTVPLSHIAIPGSHDAMAYSLDMDSPVLEPDSLKPMDNMFSAFLRPIVKKWGTAQD 74

  Fly   246 DDIRGQLMHGVRYLDIRVGYYRNSPDPFFIYHGITKQRPLQEVINQVRDFV-YETNEIIIFGLKE 309
            ..|..||..|.||.|:||.....|.| ||.|||:.....::|.:.:::.:: ..:.|::|.....
Zfish    75 KTISEQLDAGTRYFDLRVAGKPESSD-FFFYHGLYTTMTVKEAMTELKTWLGQHSKEVVILAFSH 138

  Fly   310 FPVGFGKGLGV--HRLLISYLRDQLKDLIAHPSLTWGASLRDIWARRQNVFLAYDHEAMVEEFPD 372
            |     |.:..  |..|.::|::..|..:...:..  .||:|.|.....|.|:|| :..:|:  .
Zfish   139 F-----KEMSADQHTDLTNFLKEHFKTKLCPKAKM--PSLKDCWESSYQVILSYD-DRNIED--P 193

  Fly   373 VLFGSVEQRWGNKQTWDQLETYLRNVND---------------FDVSRFSSRPVSDMAELTPETW 422
            ||:..:...|.:....:::.::|.|...               ||.:.......:.:.|.|...:
Zfish   194 VLWPRIGYWWADNSDPNEVISFLDNKKQTGRPEGLFVAGLNLTFDANDMLQYLTTSLKEKTMTAY 258

  Fly   423 DVILDKTGGLRKMADNVNWRISQLYRNELGTNANIVSADFIRGTTLVETAIEYNARK 479
            .::|:             | :.:.:......:.||::.||:...:.....|:.|..|
Zfish   259 PLLLE-------------W-VKEQHPGSGTQSINIIAGDFVGVNSFAHDVIQLNNAK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 65/310 (21%)
LOC100151335XP_001923476.1 PI-PLCXD1c 14..298 CDD:176555 65/308 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243732at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.