DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and LOC100150005

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_009290940.1 Gene:LOC100150005 / 100150005 -ID:- Length:290 Species:Danio rerio


Alignment Length:111 Identity:33/111 - (29%)
Similarity:48/111 - (43%) Gaps:22/111 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WMNDLKSKIGEMRLRDLFIPGTHDSGSYRPNFDPLLRESLVTKYALTQDDDIRGQLMHGVRYLDI 261
            ||..|..   |..:.|:.||||||:.|....           ..|..|...:..||:.|:||||:
Zfish    41 WMETLDD---EKLISDVNIPGTHDTMSLHGG-----------PAAECQSWSLHNQLLAGIRYLDL 91

  Fly   262 RVGYYRNSPDPFFIYHGITKQ-RPLQEVINQVRDFV--YETNEIII 304
            ||...:     ..|.||:..| .....|:|:...|:  |:|..::|
Zfish    92 RVWGRK-----LIIVHGVIPQFTTFANVLNKTSTFLSQYKTETVLI 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 30/106 (28%)
LOC100150005XP_009290940.1 PI-PLCc_BcPLC_like 42..289 CDD:176528 32/110 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.