DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCXD and si:dkey-152b24.6

DIOPT Version :9

Sequence 1:NP_609541.1 Gene:PLCXD / 34623 FlyBaseID:FBgn0032402 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001373297.1 Gene:si:dkey-152b24.6 / 100002310 ZFINID:ZDB-GENE-100922-31 Length:288 Species:Danio rerio


Alignment Length:318 Identity:72/318 - (22%)
Similarity:123/318 - (38%) Gaps:107/318 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WMNDL-KSKIGEMRLRDLFIPGTHDSGSYRPNFDPLLRESLVTKYALTQDDDIRGQLMHGVRYLD 260
            ||..| .:|:    :..:.|||||.|.:.....:           |..|...:..||..|:|||:
Zfish    39 WMRTLDDNKL----ISAISIPGTHASLAVHGGPE-----------AECQSWSVESQLKAGIRYLE 88

  Fly   261 IRVGYYRNSPDPFFIYHGITKQ-RPLQEVINQVRDFV-YETNEIIIFGLK-----EFPVGFGKGL 318
            :.|     |.....:.||:..| ....:|:|.|:.|: ..|:|:::..:|     .|||      
Zfish    89 LSV-----SGRDLKVVHGLFPQYTRFSKVLNTVKKFLSIHTSEVVLVRVKHVSWDRFPV------ 142

  Fly   319 GVHRLLISYLRDQLKDLIAHPSLTWGA----SLRDIWARRQNVFLAYDHEAMVEEFPDVLFGSVE 379
               ::|     :|||:   .|. .|.:    .::|:  |.:.||:      ...:|         
Zfish   143 ---KVL-----NQLKN---DPD-CWVSDKIPQIKDV--RGKIVFV------QTNDF--------- 178

  Fly   380 QRWGNKQTWDQLETYLRNVNDFDVSRFSSRPV--------------SDMAELTPET---WDVI-L 426
                 |.....:||  .:.||:.||....:..              :|:|.|:..:   |.|: |
Zfish   179 -----KLGISLIET--DDKNDYKVSHIGVKEAKIAKHLNEALKDCKADLAVLSYSSGTGWPVLRL 236

  Fly   427 DKTGGLRKMADNVN-WRISQLYRNELGTNA-------NIVSADFIRGTTLVETAIEYN 476
            |.|.  :.:|..:| |    ||....|.::       .|::.|| .|..|::..|.:|
Zfish   237 DLTP--KVVAKKINRW----LYDYLGGISSLKSKRCFGILAMDF-PGFALIQRIIGFN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLCXDNP_609541.1 PI-PLCXDc_CG14945_like 202..479 CDD:176559 69/312 (22%)
si:dkey-152b24.6NP_001373297.1 PI-PLCc_GDPD_SF 40..287 CDD:417475 70/315 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.