DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and ZBTB14

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001137295.1 Gene:ZBTB14 / 7541 HGNCID:12860 Length:449 Species:Homo sapiens


Alignment Length:467 Identity:111/467 - (23%)
Similarity:189/467 - (40%) Gaps:84/467 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SQTMQSIPTLHQPLHSKVSNYLNNQRRTGQFCDLLLELDSDDSLSLSVHFCVLAAQSQFINSNQK 68
            |:|::.....|:.|..|.   ||.||..|:|||:.:.:   :.:....|.|||||.|.:.....|
Human     8 SETIKYNDDDHKTLFLKT---LNEQRLEGEFCDIAIVV---EDVKFRAHRCVLAACSTYFKKLFK 66

  Fly    69 QQQFSIHNPLKITIRNFSCTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAVTELLNL----- 128
            :.:....:.::|   :|..:.....::::.|...:||.||.........|||.:..|..|     
Human    67 KLEVDSSSVIEI---DFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKR 128

  Fly   129 ---------------YQL---QPLGEAKEA--TEIPAPGEAQPNPDPE------------KKAEA 161
                           |.|   :|:|:|.:.  .::...|:...:|..:            |....
Human   129 DVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTT 193

  Fly   162 VFENRQSYFKLKNPRAVKSSSKVNYCIGCDFKCYQVQKMIEHMGSCEPSHLICS--LCEV----- 219
            ....:::..|......|:   ||| |.|.:.:..:..:. :.:||..|..|..:  :.||     
Human   194 TLRVQEAILKELGSEEVR---KVN-CYGQEVESMETPES-KDLGSQTPQALTFNDGMSEVKDEQT 253

  Fly   220 -GF--------LDWREYDTHLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTETPHICPHC 275
             |:        .::..|..|        |:...|..||..|:....|..|:..|:.:.|.:|..|
Human   254 PGWTTAASDMKFEYLLYGHH--------REQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMC 310

  Fly   276 GKGFKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLLHTGEF-FACTVSGCKHRANRK 339
            .|||..:..|..|:.:|...|...|:|||.|......||.|:.:|:.|. |||.:  |......|
Human   311 TKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHM--CDKAFKHK 373

  Fly   340 ENLKLHIETHKQGRDFICEVCGCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHV 404
            .:||.|...|:..:.|:|..|...|:::.:||||     ||..:..:.|:.. |:.:|:..:...
Human   374 SHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRH-----ENNMHSERKQVTP-SAIQSETEQLQA 432

  Fly   405 QRVHTEKPVQLE 416
            ..:..|...|||
Human   433 AAMAAEAEQQLE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 59/226 (26%)
C2H2 Zn finger 214..234 CDD:275368 5/35 (14%)
C2H2 Zn finger 244..264 CDD:275368 6/19 (32%)
C2H2 Zn finger 272..292 CDD:275368 7/19 (37%)
C2H2 Zn finger 300..320 CDD:275368 8/19 (42%)
C2H2 Zn finger 330..349 CDD:275368 5/18 (28%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 387..408 CDD:275368 3/20 (15%)
ZBTB14NP_001137295.1 BTB_POZ_ZBTB14 18..131 CDD:349513 31/121 (26%)
Nuclear localization signal. /evidence=ECO:0000255 50..66 7/15 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..194 5/40 (13%)
C2H2 Zn finger 279..299 CDD:275368 6/19 (32%)
SFP1 <303..383 CDD:227516 28/81 (35%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
zf-H2C2_2 319..344 CDD:404364 9/24 (38%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
C2H2 Zn finger 363..383 CDD:275368 6/21 (29%)
C2H2 Zn finger 391..407 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.