DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and ZBTB8B

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001139192.1 Gene:ZBTB8B / 728116 HGNCID:37057 Length:495 Species:Homo sapiens


Alignment Length:583 Identity:109/583 - (18%)
Similarity:174/583 - (29%) Gaps:221/583 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QPLHSKVSNYLNNQRRTGQFCDLLLELDSDDSLSLSVHFCVLAAQSQF-----INSNQKQQQFSI 74
            |..::|:...||.||:...|||..:.:   :......|..:|.|.|.:     |:..|...:.|.
Human     4 QSYYAKLLGELNEQRKRDFFCDCSIIV---EGRIFKAHRNILFANSGYFRALLIHYIQDSGRHST 65

  Fly    75 HNPLKITIRNFSCTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAVTELLNL----------- 128
            .:...:|...||      .|:||.|...:.:..|:.:.....|..|.:.:::|.           
Human    66 ASLDIVTSDAFS------IILDFLYSGKLDLCGENVIEVMSAASYLQMNDVVNFCKTYIRSSLDI 124

  Fly   129 -----------------------------YQL--QPLGEAKEATEI--------PAPGE------ 148
                                         :|:  :.....:|.|..        ||.||      
Human   125 CRKMEKEAAVAAAVAAAAAAAAAAAAAAAHQVDSESPSSGREGTSCGTKSLVSSPAEGEKSVECL 189

  Fly   149 --------------------------AQPN-PDPEKKAEA------------VFENRQSYFKLKN 174
                                      |..| ..|.|:.|.            |.|..|.|....|
Human   190 RESPCGDCGDCHPLELVVRDSLGGGSADSNLSTPPKRIEPKVEFDADEVEVDVGEQLQQYAAPLN 254

  Fly   175 PRAVKSSSKVNYCIGCDFKCYQVQKMIEHM--GSCEPS------HL--------------ICSLC 217
            ...|:.:......:...:..|.|::.:|.:  .|..||      |.              :.|:.
Human   255 LAHVEEALPSGQAVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMM 319

  Fly   218 EVGFLDWREYDTHLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTETPHICPHCGKGFKWK 282
            :|. .||...|      |||:      |...|:.                  |.||.|....|.|
Human   320 DVQ-ADWYGED------SGDV------LVVPIKL------------------HKCPFCPYTAKQK 353

  Fly   283 QGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLLHTGEFFACTVSGCKHRANRKENLKLHIE 347
            ..|..||..|..|:...|:.||...|..:.|:||.|                            .
Human   354 GILKRHIRSHTGERPYPCETCGKRFTRQEHLRSHAL----------------------------S 390

  Fly   348 THKQGRDFICEVCGCKFSQ--SKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHVQRVHTE 410
            .|:..|..||:.|...|:.  |:.|:|..|           |..|...:...|...:.:      
Human   391 VHRSNRPIICKGCRRTFTSHLSQGLRRFGL-----------CDSCTCVTDTPDDDDDLM------ 438

  Fly   411 KPVQLEL----SETVDSSFPDDFELPV-IETSPKKKPKSVKSKTIRNVNPDKRLKTLLPKETV 468
             |:.|.|    ||:.:.|..|: :.|: :|:..:..|....|.....:.|:     |..:||:
Human   439 -PINLSLVEASSESQEKSDTDN-DWPIYVESGEENDPAGDDSDDKPQIQPN-----LSDRETL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 49/233 (21%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 2/19 (11%)
C2H2 Zn finger 272..292 CDD:275368 8/19 (42%)
C2H2 Zn finger 300..320 CDD:275368 8/19 (42%)
C2H2 Zn finger 330..349 CDD:275368 0/18 (0%)
C2H2 Zn finger 357..377 CDD:275368 7/21 (33%)
C2H2 Zn finger 387..408 CDD:275368 3/20 (15%)
ZBTB8BNP_001139192.1 BTB 14..118 CDD:279045 25/112 (22%)
BTB 25..122 CDD:197585 19/105 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..178 2/20 (10%)
C2H2 Zn finger 343..363 CDD:275368 8/19 (42%)
zf-H2C2_2 356..380 CDD:290200 8/23 (35%)
C2H2 Zn finger 371..392 CDD:275368 8/48 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..495 12/55 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.