DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and ZBTB26

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001291292.1 Gene:ZBTB26 / 57684 HGNCID:23383 Length:441 Species:Homo sapiens


Alignment Length:429 Identity:96/429 - (22%)
Similarity:158/429 - (36%) Gaps:136/429 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LHSKVSNY-------LNNQRRTGQFCDLLLELDSDDSLSLSVHFCVLAAQSQFINSNQKQQQFSI 74
            ||.|..||       :|..|...:|||:.:.:   |.:.:..|..|.||.|.|:     :.||.:
Human     8 LHFKFENYGDSMLQKMNKLREENKFCDVTVLI---DDIEVQGHKIVFAAGSPFL-----RDQFLL 64

  Fly    75 HN--PLKITIRNFS------CTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAVTELLN---- 127
            ::  .:||:|...|      ...|...:::|...:||        ::...|..|.::.::.    
Human    65 NDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELV--------NYLTAASFLQMSHIVERCTQ 121

  Fly   128 -LYQL----QPLGEAKEATEIPA--------PGEAQPNPDPEK--------------------KA 159
             |::.    ||: ::||..|..:        .|:|:.:|..:.                    |.
Human   122 ALWKFIKPKQPM-DSKEGCEPQSASPQSKEQQGDARGSPKQDSPCIHPSEDSMDMEDSDIQIVKV 185

  Fly   160 EAV-------FENRQSYFKLKNPRAVKSS----SKVNYCIGCDFKCYQVQK------MIEHMGSC 207
            |::       .:..|:.|....|.|:.||    |.:|..:  :.:..::::      .:.:.||.
Human   186 ESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSLINSTV--ENRVSEIEQNHLHNYALSYTGSD 248

  Fly   208 E----------PS----------HLICSLCEVGFLDWREYDTHLRRHSGDLRKPFFCLQCGIRFN 252
            .          |:          |..|..|...|.....|..||:.|     |.|.||.||..|.
Human   249 NIIMASKDVFGPNIRGVDKGLQWHHQCPKCTRVFRHLENYANHLKMH-----KLFMCLLCGKTFT 308

  Fly   253 TRAALLVHQPKHSTETPHICPHCGKGFKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSH- 316
            .:..|..|...|:...|..|..|||.|..|..|.:|:.:|:.:|...|:.|.....|...|:.| 
Human   309 QKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHLNLHSGDKPHKCNYCDMVFAHKPVLRKHL 373

  Fly   317 KLLH----------------TGEF--FACTV----SGCK 333
            |.||                |.:|  ||||.    .||:
Human   374 KQLHGKNSFDNANERNVQDLTVDFDSFACTTVTDSKGCQ 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 48/190 (25%)
C2H2 Zn finger 214..234 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..292 CDD:275368 8/19 (42%)
C2H2 Zn finger 300..320 CDD:275368 6/20 (30%)
C2H2 Zn finger 330..349 CDD:275368 2/4 (50%)
C2H2 Zn finger 357..377 CDD:275368
C2H2 Zn finger 387..408 CDD:275368
ZBTB26NP_001291292.1 BTB_POZ_ZBTB26_Bioref 8..129 CDD:349523 30/136 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..177 6/42 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..216 6/21 (29%)
COG5236 <269..>381 CDD:227561 37/116 (32%)
C2H2 Zn finger 275..295 CDD:275368 6/19 (32%)
zf-C2H2 298..320 CDD:395048 8/21 (38%)
C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
zf-H2C2_2 315..337 CDD:404364 8/21 (38%)
C2H2 Zn finger 328..348 CDD:275368 8/19 (42%)
C2H2 Zn finger 356..374 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.