DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and Sry-delta

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster


Alignment Length:457 Identity:99/457 - (21%)
Similarity:155/457 - (33%) Gaps:156/457 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FC---DLLLELDSDDSLSLSVHFCVLAAQSQFINSNQK-------------QQQFSIHNPLKITI 82
            ||   ||     ||...|.|:.:..|:|:   :.|:||             |.|..:....::  
  Fly     6 FCGAVDL-----SDTGSSSSMRYETLSAK---VPSSQKTVSLVLTHLANCIQTQLDLKPGARL-- 60

  Fly    83 RNFSCTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAVTELLNLYQLQPLGEAKEATEIPAPG 147
                |.:|...:.|:   |.:.|:             |..|:.....||:  |..|...|:|..|
  Fly    61 ----CPRCFQELSDY---DTIMVN-------------LMTTQKRLTTQLK--GALKSEFEVPESG 103

  Fly   148 E-----------AQPNPDPEKKAEAVF-----ENRQSYFKLK----------------------- 173
            |           :....|.:.:|:|:|     :..:|..::|                       
  Fly   104 EDILVEEVEIPQSDVETDADAEADALFVELVKDQEESDTEIKREFVDEEEEEDDDDDDEFICEDV 168

  Fly   174 ---------------NPRAVKSSSKVNYCIGCD---FKCYQVQKMIEHMGSCEPSHLICSLCEVG 220
                           ..|..|...| ..|..|.   ...||:||.|....|.:|:| ||.:|.|.
  Fly   169 DVGDSEALYGKSSDGEDRPTKKRVK-QECTTCGKVYNSWYQLQKHISEEHSKQPNH-ICPICGVI 231

  Fly   221 FLDWREYDTHLRRHSGDL--------------------------RKPFFCLQCGIRFNTRAALLV 259
            ..|....:.|:..|.|..                          :|.:.|.:||:||:....|..
  Fly   232 RRDEEYLELHMNLHEGKTEKQCRYCPKSFSRPVNTLRHMRMHWDKKKYQCEKCGLRFSQDNLLYN 296

  Fly   260 HQPKH-STETPHICPHCGKGFKWKQGLSNHILVHNPEK-QMLCDVCGYSTTHMKALKSHKLLHTG 322
            |:.:| :.|.|.||..|...||.::..::|.|:|...: :..|.||..|.|....||.|...|.|
  Fly   297 HRLRHEAEENPIICSICNVSFKSRKTFNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEG 361

  Fly   323 EFFACTVSGCKHRANRKENL---KLHIET-------------HKQGRDFICEVCGCKFSQSKNLK 371
            :    .|.|.:..|...|..   :||::.             :.:...| |.:|...|...|.|:
  Fly   362 D----VVYGVREEAPADEQQVVEELHVDVDESEAAVTVIMSDNDENSGF-CLICNTNFENKKELE 421

  Fly   372 RH 373
            .|
  Fly   422 HH 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 58/225 (26%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..292 CDD:275368 6/19 (32%)
C2H2 Zn finger 300..320 CDD:275368 8/19 (42%)
C2H2 Zn finger 330..349 CDD:275368 5/34 (15%)
C2H2 Zn finger 357..377 CDD:275368 6/17 (35%)
C2H2 Zn finger 387..408 CDD:275368
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 43/155 (28%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 0/19 (0%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 310..327 CDD:275370 4/16 (25%)
zf-C2H2 337..359 CDD:278523 8/21 (38%)
C2H2 Zn finger 339..359 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.