DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and Sry-beta

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster


Alignment Length:393 Identity:88/393 - (22%)
Similarity:138/393 - (35%) Gaps:83/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 CVLAAQSQFINSNQKQQQFSIHNPLKITIRNFSCTQCLHTIVDFFYEDLVSVSKEHELHFRELAQ 118
            |::....:.|....|..:..|:..|::...:.:|..||..:  |.|:.||          |.|:|
  Fly    26 CIVPGTFKPIKDILKYFEKIINQRLELLPNSAACRDCLEYL--FNYDRLV----------RNLSQ 78

  Fly   119 I--LAVTELLNLYQLQPLGEAK-----------------EATEIPAPGEAQPNPDPEKKAEAVFE 164
            :  .....||...|::...|.|                 :||.:..| |.||..:.|.:.....|
  Fly    79 VQRQIADALLGCRQVEGKAETKQQAAKRARVQVPAFKIVQATALKEP-ERQPGEEDECEEFMKEE 142

  Fly   165 NRQSYFKLKNPRAVKSSSKVNYCIGCDFKCYQVQKMIEHMGSCEPSHLICSLCEVGFLDWREYDT 229
            .....|:...|.....||:..:                   ..|.:.:.|.:|...|......:.
  Fly   143 MLDEEFQFSEPDDSMPSSEEEF-------------------FTETTEIPCHICGEMFSSQEVLER 188

  Fly   230 HLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTETPHICPHCGKGFKWKQGLSNHILVHNP 294
            |::..:....:...|..||::......|.:|...|..:|...|.:|.|.|..|:.:..|:.||..
  Fly   189 HIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWD 253

  Fly   295 EKQMLCDVCGYSTTHMKALKSHKLLHTGEFFACTVSGCKHRANRKENLKLHIETHKQGRDFICEV 359
            :|:..||.||...:....:.:|.:.|..|                ||.            .||||
  Fly   254 KKKYQCDKCGERFSLSWLMYNHLMRHDAE----------------ENA------------LICEV 290

  Fly   360 CGCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHVQRVH--TEKPVQLELSETVD 422
            |..:|...:..|.|...|..:.| ||.|..|..|......:|.| :|||  .|||...|..|...
  Fly   291 CHQQFKTKRTYKHHLRTHQTDRP-RYPCPDCEKSFVDKYTLKVH-KRVHQPVEKPESAEAKEATV 353

  Fly   423 SSF 425
            :.|
  Fly   354 TFF 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 46/209 (22%)
C2H2 Zn finger 214..234 CDD:275368 4/19 (21%)
C2H2 Zn finger 244..264 CDD:275368 5/19 (26%)
C2H2 Zn finger 272..292 CDD:275368 6/19 (32%)
C2H2 Zn finger 300..320 CDD:275368 5/19 (26%)
C2H2 Zn finger 330..349 CDD:275368 2/18 (11%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 387..408 CDD:275368 6/20 (30%)
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..251 CDD:275368 6/19 (32%)
C2H2 Zn finger 259..308 CDD:275368 17/76 (22%)
C2H2 Zn finger 288..303 CDD:275370 5/14 (36%)
zf-C2H2 315..337 CDD:278523 7/22 (32%)
C2H2 Zn finger 317..337 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.