DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and CG4424

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster


Alignment Length:166 Identity:52/166 - (31%)
Similarity:76/166 - (45%) Gaps:18/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 HQPKHSTETP----------HICPHCGKGFKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMK-AL 313
            :.|..||..|          |:|..||.|:..|..|..|:..||.|:...|::| :.:.|:. .|
  Fly   167 YPPPASTPPPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEIC-HKSFHVNYQL 230

  Fly   314 KSHKLLHTG-EFFACTVSGCKHRANRKENLKLHIETHKQGRDFICEVCGCKFSQSKNLKRHALKH 377
            |.|...||| :.:.|..  |:.....:.:|..|..||:..|.:.|:.||.||:.:..||.|...|
  Fly   231 KRHIRQHTGAKPYTCQY--CQRNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTH 293

  Fly   378 TENGPNRYKCQLCGFSSHRSDKMKEHVQ-RVHTEKP 412
            |  |...:.||||..|..|...:..|:| :.|...|
  Fly   294 T--GEKPHICQLCNKSFARIHNLVAHLQTQQHINDP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 48/154 (31%)
C2H2 Zn finger 214..234 CDD:275368
C2H2 Zn finger 244..264 CDD:275368 1/3 (33%)
C2H2 Zn finger 272..292 CDD:275368 7/19 (37%)
C2H2 Zn finger 300..320 CDD:275368 6/20 (30%)
C2H2 Zn finger 330..349 CDD:275368 3/18 (17%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
C2H2 Zn finger 387..408 CDD:275368 8/21 (38%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
DUF45 <204..281 CDD:302795 24/79 (30%)
COG5048 210..>345 CDD:227381 39/123 (32%)
C2H2 Zn finger 217..237 CDD:275368 6/20 (30%)
C2H2 Zn finger 245..265 CDD:275368 4/21 (19%)
zf-H2C2_2 257..282 CDD:290200 10/24 (42%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..310 CDD:290200 11/25 (44%)
C2H2 Zn finger 301..320 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.