DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and CG8319

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster


Alignment Length:397 Identity:100/397 - (25%)
Similarity:157/397 - (39%) Gaps:74/397 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LELDSDDSLSLSVHFCVLAAQSQFINSNQKQQQFSIHNPLKITIRNFSCTQCLH---TIVDFFYE 100
            ::||.||::                             |.|:      |..|:|   |...|   
  Fly    42 VQLDPDDAM-----------------------------PQKM------CISCVHDARTAYGF--- 68

  Fly   101 DLVSVSKEHELHFRELAQILAVTELLN--LYQLQPLGEAKEATEIPAPG--EAQPNPDPEKKAEA 161
                 .:..|.::::.  .||:   ||  :.:.:|..|.....|.|..|  ||:...:.|.|...
  Fly    69 -----KRRCEENYKKF--YLAI---LNGQVIKDEPNEEDFLFIENPDKGNLEAKKKLNKEIKKTH 123

  Fly   162 VFENRQSYFKLKNPRAVKSSSKV-NYCIGCDFKCYQVQK---MIEHMGSCEPSHLICSLCEVGFL 222
            ...:|.:...:...||.:....: |....|:....|.::   :::||.....|| :|..||..||
  Fly   124 QTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQINLLDHMKVHSNSH-VCQNCEERFL 187

  Fly   223 DWREYDTH-LRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTE-TPHICPHCGKGFKWKQGL 285
            ...:.|.| ..|:|....:   |.:|...|::..:|..|:.|...| :|..||||.:.|..:|.|
  Fly   188 FKADLDNHQCYRNSNSTVE---CPECLKVFSSTQSLDSHKCKDMQERSPFQCPHCQQAFTREQNL 249

  Fly   286 SNHILVHNPEKQ----MLCDVCGYSTTHMKALKSHKLLHTGEF-FACTVSGCKHRANRKENLKLH 345
            ..|:|:|...||    ..|..|.....:..|||.|...|.||. .||..  |......|:.||:|
  Fly   250 KAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPF--CVSNFRSKQALKVH 312

  Fly   346 IETHKQGRDFICEVCGCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHVQRVHTE 410
            |..|...:.:.|..|...||.:.||.:|..:|::..|  |||.:|.........:|.|....|.:
  Fly   313 IRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERP--YKCSICLQDFREKHHLKRHFLGKHRD 375

  Fly   411 KPVQLEL 417
            ...:|:|
  Fly   376 GDQKLKL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 66/219 (30%)
C2H2 Zn finger 214..234 CDD:275368 7/20 (35%)
C2H2 Zn finger 244..264 CDD:275368 5/19 (26%)
C2H2 Zn finger 272..292 CDD:275368 9/19 (47%)
C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..349 CDD:275368 6/18 (33%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 387..408 CDD:275368 4/20 (20%)
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 12/79 (15%)
COG5048 <153..368 CDD:227381 67/222 (30%)
C2H2 Zn finger 153..173 CDD:275368 4/19 (21%)
C2H2 Zn finger 179..196 CDD:275368 6/16 (38%)
C2H2 Zn finger 207..227 CDD:275370 5/19 (26%)
C2H2 Zn finger 236..256 CDD:275368 9/19 (47%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 7/21 (33%)
zf-H2C2_2 308..332 CDD:290200 7/23 (30%)
zf-C2H2 322..344 CDD:278523 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..368 CDD:275368 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.