DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and CG1024

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster


Alignment Length:254 Identity:47/254 - (18%)
Similarity:89/254 - (35%) Gaps:97/254 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 HICPHCGKGFK----WKQGL-----------SNHILVHNPEKQMLCDVC------GYSTTHMKAL 313
            :|||.|||.|:    |:|.|           |:...:...|:...|.:|      .:.|  :..|
  Fly    28 YICPECGKAFRTQAEWRQHLNTKHDYLKKTYSDFNFIQIDERFHECQLCFKWVENAHKT--IALL 90

  Fly   314 KSHKLLHT--GEFFACTVSGCKHRANRKENLKLH-IETHKQGRDFICEVCGCKF-SQSKNLKRHA 374
            :.|..:|.  .|.:.|.  .|:....|:..|.:| ::||.:..:        |: ::.:.:||..
  Fly    91 QYHYFMHLEHSETYRCV--HCRMAYTRRRALNVHLLDTHMREIE--------KYENKLRQMKRQQ 145

  Fly   375 LKHT---------------------ENGPNRYKCQLCGFSSHRSDKMKEHVQRVHTEKPVQLELS 418
            .|.|                     :...||              |..:.:|:...:..:..|:.
  Fly   146 AKPTTAAAPAGNAEKPMAVKPRGRPKGSTNR--------------KQNDLLQKALMDIDLNTEME 196

  Fly   419 ETVDSSFPDDFELPVIE-TSPKKKPKSVKSKTIRNVNPDKRL-----------KTLLPK 465
            ::           ||.. .:|..:||.:.:  :..:|.|:.|           |.::||
  Fly   197 KS-----------PVTALAAPVNEPKPISN--VSELNLDRCLNAYEDIVRKEEKEVVPK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 34/178 (19%)
C2H2 Zn finger 214..234 CDD:275368
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..292 CDD:275368 10/34 (29%)
C2H2 Zn finger 300..320 CDD:275368 5/25 (20%)
C2H2 Zn finger 330..349 CDD:275368 4/19 (21%)
C2H2 Zn finger 357..377 CDD:275368 3/20 (15%)
C2H2 Zn finger 387..408 CDD:275368 2/20 (10%)
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368 9/20 (45%)
C2H2 Zn finger 73..100 CDD:275368 6/28 (21%)
C2H2 Zn finger 106..123 CDD:275368 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.