DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and Neu2

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster


Alignment Length:407 Identity:93/407 - (22%)
Similarity:128/407 - (31%) Gaps:122/407 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QFSIHNPLKITIRNFSCTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAVTELLNLYQLQPLG 135
            |...|:||..||    |..||....:.|  |::...:.....:|.|..:                
  Fly    26 QVEKHDPLSNTI----CKSCLEDAQNAF--DIIETYERSHQFYRFLKDV---------------- 68

  Fly   136 EAKEATEIPAPGEAQPNPDPEKKAEAVFENRQSYFKLKNPRAVKSSSK--VNYCIGCDFKCYQVQ 198
             .:|.:|....|.::       :.||...:.|.     ....|.|.::  :|   .||.|     
  Fly    69 -REEESENDGSGCSE-------EVEAAERDLQD-----GADDVDSGNEPDIN---ECDIK----- 112

  Fly   199 KMIEHMGSCEPSHLICSLCEVGFLDWREYDTHLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPK 263
                   :.|.....||.|...|........|:|.|:|:  :||.|..|...|...:.|..|...
  Fly   113 -------AKEKPGFSCSHCPKSFQVKSNLKVHMRSHTGE--RPFTCSLCPKSFGYSSGLQNHMRT 168

  Fly   264 HSTETPHICPHCGKGFKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLLHTGEF-FAC 327
            |:.|.|..|.||.:.|.....|..||.:|.....:.|..|.........||.|...||.|. |.|
  Fly   169 HTGERPFQCSHCPRSFTAGHHLKAHIQMHERRGSLRCPYCQKCFLTSLILKQHLATHTDETQFKC 233

  Fly   328 TVSGCKHRANRKENLKLHIETHKQGRDFICEVCGCKFSQSKNLKRH------------------- 373
              |.|......:..|.:|:..| |.|.|.|..|...|:....||||                   
  Fly   234 --SQCSKSFQVEHELWMHMRVH-QERLFTCGHCSKDFALHAYLKRHLSRNARCSQSSKASAHKTL 295

  Fly   374 ----ALK--------------------HTENGP--------------------NRYKCQLCGFSS 394
                |||                    ||:|.|                    ..:||..|..:.
  Fly   296 GHSKALKCGKCPKTFTDRSALSTHLKSHTKNKPLLEGPCKSSGSKPAHSNAQRKPFKCSSCPRTF 360

  Fly   395 HRSDKMKEHVQRVHTEK 411
            .|...:..|:| .||.|
  Fly   361 SRKSALLTHLQ-THTGK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 64/273 (23%)
C2H2 Zn finger 214..234 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 5/19 (26%)
C2H2 Zn finger 272..292 CDD:275368 7/19 (37%)
C2H2 Zn finger 300..320 CDD:275368 5/19 (26%)
C2H2 Zn finger 330..349 CDD:275368 4/18 (22%)
C2H2 Zn finger 357..377 CDD:275368 10/62 (16%)
C2H2 Zn finger 387..408 CDD:275368 5/20 (25%)
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 11/42 (26%)
COG5048 <119..241 CDD:227381 38/125 (30%)
C2H2 Zn finger 121..141 CDD:275368 6/19 (32%)
zf-H2C2_2 133..158 CDD:290200 9/26 (35%)
C2H2 Zn finger 149..169 CDD:275368 5/19 (26%)
zf-H2C2_2 162..185 CDD:290200 8/22 (36%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
zf-C2H2_8 206..286 CDD:292531 24/82 (29%)
C2H2 Zn finger 233..253 CDD:275368 5/21 (24%)
C2H2 Zn finger 260..297 CDD:275368 7/36 (19%)
C2H2 Zn finger 303..323 CDD:275368 0/19 (0%)
C2H2 Zn finger 353..373 CDD:275368 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.