DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and CG10654

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:393 Identity:78/393 - (19%)
Similarity:145/393 - (36%) Gaps:89/393 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DLLLELDSDDSLSLSVHFCVLAAQSQFINSNQKQQQFSIHN-PLKITIRNFSCTQCLHTIVDFFY 99
            |....|||:..|:...:.|.              .:.::.: |.::.::  |..:|.:.:|..|:
  Fly    51 DACHNLDSEQDLASKYYGCT--------------GEDAVRDLPPQLVLK--SICECCYQLVQKFH 99

  Fly   100 EDLVSVSKEHELHFRELAQILAVTELLNLYQLQPLGEAKEATEIPAPGEAQPNPDPEKKAE---- 160
             |...:..|...:|.:|.|.:.:    ..::|    |.....::..|.|:..:.:||.::.    
  Fly   100 -DFQRMCAESLRNFEKLLQDIDI----GCHKL----EDHTWHDLDTPSESNESTNPEAQSHAPCI 155

  Fly   161 ------------------AVFENR--------QSYFKLKNPRAVKSSSKVNYCIGCDFKCYQVQK 199
                              ||..:|        :..:.:::..|.:...:....|.......:.::
  Fly   156 AATQEIVSFIWPQVCLPLAVILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRR 220

  Fly   200 MIEHMGSCEPSHLICSLCEVGFLDWREYDTHLRRHSGDLRKPFFCLQCGIRFNTRAALL------ 258
            .:.|.       |.|.:|..||......:.|:::|.|  .:|:.|:.|...: .||.||      
  Fly   221 GVRHT-------LECRICHRGFYKPSLLEAHMQQHEG--LRPYTCVHCAKSY-ARANLLESHLRQ 275

  Fly   259 VHQPKHSTETPHICPHCGKGFKWKQGLSNHI-LVH-------NPEKQMLCDVCGYSTTHMKALKS 315
            :|....:....:.||.|.|.:...:.|..|: ..|       :|:.:.:|:.||........|..
  Fly   276 MHNNADAARIIYACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTR 340

  Fly   316 HKLLH---TGEFFACTVSGCKHRANRKENLKLHIETHKQGRDFI---CEVCGCKFSQSKNLKRHA 374
            ||::|   .|..:.|..  |..|...|||:..|: ..|.|...:   |..||..|..|..|..|.
  Fly   341 HKMVHGSVEGRRYCCEC--CDRRFYTKENMVDHL-LRKHGNKNLLLRCRKCGRIFQNSVELNAHG 402

  Fly   375 LKH 377
            .||
  Fly   403 RKH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 51/205 (25%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 7/25 (28%)
C2H2 Zn finger 272..292 CDD:275368 6/20 (30%)
C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..349 CDD:275368 6/18 (33%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 387..408 CDD:275368
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 14/80 (18%)
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
C2H2 Zn finger 256..313 CDD:275368 14/57 (25%)
C2H2 Zn finger 289..314 CDD:275368 7/24 (29%)
zf-C2H2 323..345 CDD:278523 6/21 (29%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 355..376 CDD:275368 7/23 (30%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.