DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and CG7386

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster


Alignment Length:516 Identity:115/516 - (22%)
Similarity:183/516 - (35%) Gaps:181/516 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RNFSCTQCLHTIVDFFYEDLVSVSKEHELH-FRELA--QILAVTELLNLYQLQPLG--------- 135
            ||. ||||.              :|.::|| ||||.  .|..:.|::...:..|:|         
  Fly    52 RNL-CTQCF--------------TKLNDLHDFRELCAESIKRLKEMMTSQRNMPMGVFESIADDS 101

  Fly   136 EAKEATEIPAPGEAQPNPDP--EKKAEAVFENRQSYFKL--KNPRAVKSSSKVNYCIGCDFKCYQ 196
            ||.|..|.||      :.||  ..|.|.: :|.:..|||  |..:.::..|:             
  Fly   102 EAPERPEEPA------SFDPLLNNKLEMI-DNEEDVFKLLEKVDKELEEHSR------------- 146

  Fly   197 VQKMIEHMGSCEPSHL----------------------------------ICSLCEVGFLDWREY 227
             .:..||..|.|.:.|                                  .||:|:..|....::
  Fly   147 -DQSEEHFSSAEHNGLEEEKKESEGFNSDDEQAMGQRRIANDKRKLFRLMSCSICQQKFKKQSKF 210

  Fly   228 DTHLRRHSGDL----------RKPF---------------------------------------- 242
            :.|::.|: ||          ||.|                                        
  Fly   211 EEHMKHHN-DLLPFQCQEESCRKGFTTAGALRLHVDYAHSKKEDTVPCTVEGCQLVFSRLRLLTI 274

  Fly   243 ------------------FCLQCGIRFNTRAALLVHQPKHS-TETPHICPHCGKGFKWKQGLSNH 288
                              .|.:||:.|....|:..|...|: .|.|:.|..|||||.....|.||
  Fly   275 HLKKVHNQARVIAPRGEQSCKECGVVFRCPVAMKKHMYTHTGEELPYPCTICGKGFYINSALKNH 339

  Fly   289 ILVHNPEKQMLCDVCGYSTTHMKALKSHKLLHT-GEFFACTVSGCKHRANRKENLKLHIE-THKQ 351
            :|.|...|..:|..||...|..:....|.|:|| ...|.|.:  |.:..:.|..|:.|:: .|::
  Fly   340 LLRHAGIKNYVCQYCGVRKTTRQEWSKHILIHTQRNQFKCRI--CDYATHTKRVLESHVKIVHEK 402

  Fly   352 GRDFICEVCGCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHVQRVHTEKPV--- 413
            .|:|.|:.||..|.::...|.|.:.||  |..|.:|::|......|:.:..|: ::| ||.|   
  Fly   403 IRNFACQYCGKTFGKAYACKIHEMAHT--GEKRCECKVCDKKFLHSESLNNHL-KIH-EKSVERA 463

  Fly   414 -----QLELSETVDSSFPDDFELPVI----ETSPKKKPKSVKSKTI-----RNVNPDKRLK 460
                 |::::.....:..|..:|..:    ..|..|.|:.|:...:     ..|||...::
  Fly   464 LETYKQVQVNGDASDTQVDSHQLLKVYAESVASIPKNPRRVEQVDVALLAGTAVNPTDEIQ 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 67/314 (21%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 6/19 (32%)
C2H2 Zn finger 272..292 CDD:275368 10/19 (53%)
C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..349 CDD:275368 4/19 (21%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 387..408 CDD:275368 4/20 (20%)
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 14/43 (33%)
C2H2 Zn finger 197..217 CDD:275368 5/19 (26%)
C2H2 Zn finger 294..314 CDD:275368 6/19 (32%)
C2H2 Zn finger 323..343 CDD:275368 10/19 (53%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..400 CDD:275368 5/22 (23%)
C2H2 Zn finger 408..428 CDD:275368 6/19 (32%)
C2H2 Zn finger 436..456 CDD:275368 4/20 (20%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.