DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and Oaz

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001188929.1 Gene:Oaz / 36609 FlyBaseID:FBgn0284250 Length:1366 Species:Drosophila melanogaster


Alignment Length:415 Identity:96/415 - (23%)
Similarity:142/415 - (34%) Gaps:111/415 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LLNLY---QLQPLG-EAKEATEIPAPGEAQPNPDPEKKAEAVFE----NRQ---------SYFKL 172
            |:.:|   ...|.| |....::.|||....| |.|...:.|.|.    .||         |:.||
  Fly   945 LMEMYAAKSTSPSGNEGVGNSQPPAPQATAP-PPPPNASTATFSCGMCERQDLRSEAELHSHRKL 1008

  Fly   173 KNPRAVKSSSKVNYCIGCDFKCYQVQKMIEHMGSCEPS---HLICSLCEVGFLDWREYDTHLRRH 234
            .:......|.:..||.| :||  ...::.:||.||..|   |. |.:|:..|........|..:|
  Fly  1009 AHNLKTGVSLRCAYCAG-NFK--SRAELEQHMKSCHNSTGKHK-CLICDEVFPSPAILAEHKLQH 1069

  Fly   235 S--GDLRKPFFCLQCGIRFNTRAALLVHQPKHSTE---TPHICPHCGKGFKWKQGLSNHILVHNP 294
            |  |...|   |..||......||...|..:|.::   .|..|..|.:....:..||.|...|..
  Fly  1070 SKVGQSGK---CSHCGQPLEDVAAFRAHLSEHGSDGASLPLACICCRQTLHSEFELSLHAKFHTK 1131

  Fly   295 E-------KQMLCDVC---------GYSTTHMKALKSHKL-----LHT----------GEFFACT 328
            .       ::.:|.:|         |.:....|..:.|.|     .|:          ..|....
  Fly  1132 SSSSGGSLQEPVCALCLEPLPDATEGPAKLCDKCCRKHNLNGKRGKHSEPATSLPAPPSAFVENR 1196

  Fly   329 VSGCK----HRANRKENLKLHIETHKQGRDFICEVCGCKFSQSKNLKRHALKHTENGPNRYKCQL 389
            .:.||    |....:|:|..|.....:.|.|.|.:|...|:....|..|..:|..:. ..|.|.|
  Fly  1197 CNLCKMILPHAQKLQEHLVEHTFAGTEQRGFNCYICSAVFTAPGGLLNHMGEHGAHS-RPYDCNL 1260

  Fly   390 CGFSSHRSDKM-----KEHVQRVHTEKPVQLELSETVDSSFPDDFELPVIETSPKKKPKSVKSK- 448
            |      .:|.     .||.||.|                          |..|:.:|.:.|.: 
  Fly  1261 C------PEKFFFRAELEHHQRGH--------------------------ELRPQARPPAAKVEV 1293

  Fly   449 -TIRNVNPDK---RLKTLLPKETVE 469
             :|||.:|.:   |..|::.:|..|
  Fly  1294 PSIRNTSPGQSPVRSPTIVKQELYE 1318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 56/257 (22%)
C2H2 Zn finger 214..234 CDD:275368 4/19 (21%)
C2H2 Zn finger 244..264 CDD:275368 6/19 (32%)
C2H2 Zn finger 272..292 CDD:275368 5/19 (26%)
C2H2 Zn finger 300..320 CDD:275368 6/33 (18%)
C2H2 Zn finger 330..349 CDD:275368 6/22 (27%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
C2H2 Zn finger 387..408 CDD:275368 8/25 (32%)
OazNP_001188929.1 C2H2 Zn finger 294..314 CDD:275368
C2H2 Zn finger 322..342 CDD:275368
zf-H2C2_2 334..359 CDD:290200
COG5048 336..769 CDD:227381
zf-C2H2 348..370 CDD:278523
C2H2 Zn finger 350..370 CDD:275368
C2H2 Zn finger 378..398 CDD:275368
C2H2 Zn finger 630..650 CDD:275368
C2H2 Zn finger 659..679 CDD:275368
C2H2 Zn finger 689..707 CDD:275368
C2H2 Zn finger 1020..1041 CDD:275368 8/23 (35%)
C2H2 Zn finger 1049..1069 CDD:275368 4/19 (21%)
C2H2 Zn finger 1197..1217 CDD:275368 5/19 (26%)
C2H2 Zn finger 1229..1246 CDD:275368 4/16 (25%)
C2H2 Zn finger 1258..1278 CDD:275368 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.