DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and CG17328

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster


Alignment Length:357 Identity:88/357 - (24%)
Similarity:132/357 - (36%) Gaps:66/357 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 FSIHNPLKITIRNFSCTQCLHTIVDFFYEDL-------------VSVSKEHEL------------ 111
            ::||...::      |.:.||.:...:..|.             :.|.|...|            
  Fly     3 YNIHKICRV------CLEELHPVTSIYSTDFAMMPSVMLMQCAKIRVFKTDGLPSVICNNCIYRL 61

  Fly   112 ----HFRELAQ--ILAVTELLNLYQLQPLGEAKEATEIPAPGEAQPNPDPEKKAEAVFENRQSYF 170
                ||::..:  .|.:.:.|.:.:......|.....:..|...|.:.|.|:..:|....|:|.:
  Fly    62 GVAFHFKQECENSDLRLRQYLGILESWRQDAATNTDFVEKPLLPQRDSDEEEPVDAKVSKRRSRY 126

  Fly   171 KLKNP-----RAVKSSSKVNY-CIGC--DFKCYQ--VQKMIEHMGSCEPSHLICSLCEVGFLDWR 225
            :.|.|     |..|...|:.: |..|  .|||..  .|.:..|.|. :|..  ||.|...|....
  Fly   127 QRKPPEEHKKRGPKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGE-KPYQ--CSFCIQRFAQKY 188

  Fly   226 EYDTHLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTETPHICPHCGKGFKWKQGLSNHIL 290
            ....|.|.|:||  |||.|..|..:|:.......||..|......:|..|.|||.....||.|::
  Fly   189 NLKVHERTHTGD--KPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMI 251

  Fly   291 VHNPEKQMLCDVCGYSTTHMKALKSHKL-LHTGEFFACTVSGCKHRANRKENLKLHIETHKQGRD 354
            .|...|...|||||.:.:..:.:::||| ||..|      |...|.....::.:. |:|...|.|
  Fly   252 THTGIKNHHCDVCGKAFSRRRDMRTHKLKLHPLE------SSTNHDIVDDDDDEA-IDTDPVGLD 309

  Fly   355 ------FICEVCGCKFSQSKNLKRHALKHTEN 380
                  |.|..|...|..:.:|..|...|..|
  Fly   310 TLDHAHFKCPDCDKAFDTADSLSLHFRTHAAN 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 59/197 (30%)
C2H2 Zn finger 214..234 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 5/19 (26%)
C2H2 Zn finger 272..292 CDD:275368 8/19 (42%)
C2H2 Zn finger 300..320 CDD:275368 8/20 (40%)
C2H2 Zn finger 330..349 CDD:275368 3/18 (17%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
C2H2 Zn finger 387..408 CDD:275368
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 10/77 (13%)
COG5048 146..>211 CDD:227381 23/69 (33%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 177..197 CDD:275368 6/19 (32%)
zf-H2C2_2 189..213 CDD:404364 10/25 (40%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
C2H2 Zn finger 233..253 CDD:275368 8/19 (42%)
zf-H2C2_2 245..270 CDD:404364 10/24 (42%)
C2H2 Zn finger 261..282 CDD:275368 8/20 (40%)
C2H2 Zn finger 318..338 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.