DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and CG4496

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster


Alignment Length:414 Identity:88/414 - (21%)
Similarity:142/414 - (34%) Gaps:107/414 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VSKEHELHFRELAQILAVTELLNLYQLQPLGEAKEATEIPAPG----------EAQPNP------ 153
            |:.:.||..|.:.:::|..||.:....:. .|..|...:|:..          :...||      
  Fly   142 VTPDIELIPRRVHRVVAEIELSDSDHDED-SEVDEDVSLPSNAVSCVLNEQRQDGSQNPQELVII 205

  Fly   154 -----DPEKKAEAVFENRQSYFK---LKNPRAVKSSSKVNYCIGCDFKC---YQVQK-MIEHMGS 206
                 :.|:|.:.|.:.:.|..:   .:.|.|.:....:..|..|..|.   |.::: |:.|.|.
  Fly   206 VPSDQEDEQKTDNVIKRKSSGSRRLVKRRPGANRRGRHMYECPDCGKKVQSNYNLRRHMMIHTGE 270

  Fly   207 CEPSHLICSLCEVGFLDWREYDTHLRRHSGDLRKPFFCLQCGI-----RFNTRAA------LLVH 260
             .|  ..|.|||..|.::.:...|.||||.|  ..|.|:.|.:     :.:||.|      |:|.
  Fly   271 -RP--FPCDLCERRFREFSDLKKHRRRHSHD--PQFICMICHLGAPLEQDSTRCADCESKNLMVK 330

  Fly   261 -QP---------KHSTE-----------------TPHIC---------------PHCGKGFKWKQ 283
             ||         :||.|                 .|.:.               |        .:
  Fly   331 PQPEELGEKTTEEHSDEMEGDDDEIEEAALENEKQPQVATQPSLMVTLIPPIQSP--------PE 387

  Fly   284 GLSNHILVHNPEKQMLCDVCGYST--THMKALKSHKLLHTGEFFACTVSGCKHRANRKENLKLHI 346
            .:.:|.....|.....|.....|:  ::...:....:..|...:.|.:  |......:.|||.|.
  Fly   388 KVPSHTQPSRPPLPRSCSSANSSSSLSNDGNIAGKSMSRTRRSYPCPL--CHRPFGTRHNLKRHY 450

  Fly   347 ETHKQGRDFICEVCGCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHR-----SDKMKEHVQR 406
            ..|...:.|.|..|...|.:...||:|.:.|..:  ..|||..|. |..|     ||....|..:
  Fly   451 MIHTGEKPFSCSKCRKPFRECSTLKKHMVTHVRD--RWYKCLRCP-SKFRDYLEYSDHKNNHQDQ 512

  Fly   407 VHTEKPVQLELSETVDSSFPDDFE 430
            :.:.|....|..:..|||..|..|
  Fly   513 LSSRKSSIYESDDDGDSSVEDCLE 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 60/273 (22%)
C2H2 Zn finger 214..234 CDD:275368 7/19 (37%)
C2H2 Zn finger 244..264 CDD:275368 9/40 (23%)
C2H2 Zn finger 272..292 CDD:275368 2/34 (6%)
C2H2 Zn finger 300..320 CDD:275368 2/21 (10%)
C2H2 Zn finger 330..349 CDD:275368 5/18 (28%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 387..408 CDD:275368 7/25 (28%)
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 5/21 (24%)
C2H2 Zn finger 247..267 CDD:275368 5/19 (26%)
zf-H2C2_2 259..282 CDD:290200 8/25 (32%)
C2H2 Zn finger 275..295 CDD:275368 7/19 (37%)
zf-C2H2 431..453 CDD:278523 6/23 (26%)
C2H2 Zn finger 433..453 CDD:275368 6/21 (29%)
zf-H2C2_2 445..468 CDD:290200 8/22 (36%)
C2H2 Zn finger 461..481 CDD:275368 6/19 (32%)
C2H2 Zn finger 489..510 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.