DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and CG9609

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:398 Identity:92/398 - (23%)
Similarity:135/398 - (33%) Gaps:135/398 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LGEAKEATEIPAPGEAQPNPDPEKKAEAVFE-----NRQSYFKLKNPRAVKSSSKVNYCI--GCD 191
            :|.||.|..:|             |.||.|:     :|..|.        .:..|.:.|.  |||
  Fly    30 IGSAKYACSMP-------------KCEATFKRLDQLDRHEYH--------HTGIKKHACSYEGCD 73

  Fly   192 FKCYQV--------QKMIEHMGSCEPSHLICSL--CEVGFLDWREYDTHLRRHSGDLRKPFFCLQ 246
             |.|.:        :...|...|.....:.|:|  |...|:.......|: |.:.:..|.:.|.|
  Fly    74 -KTYSIVTHLKRHLRSTHERPESAAKKTVKCALEECSKMFISVSNMTRHM-RETHESPKVYPCSQ 136

  Fly   247 CGIRFNTRAALLVHQ-PKHSTETPHICPHCGKGF--------------------------KWK-- 282
            |..:|:.:..|..|: .:|:.|.|:.|..|.:||                          ||.  
  Fly   137 CSAKFSQKLKLKRHEIREHTLEYPYSCSKCSRGFYQQWQCQSHEPSCKLYECPGCPLQFDKWTLY 201

  Fly   283 --------QGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSH------KLLHTGE---FFACTVS 330
                    .|.:.|          .||.|..:......||.|      :...|.|   .|.|...
  Fly   202 TKHCRDSLHGKNRH----------KCDRCDSAFDKPSELKRHLEVKHKEAAQTDECATSFTCNEE 256

  Fly   331 GCKHRANRKENLKLHIETHKQGRDFICEV--CGCKFSQSKNLKRHALKHTENG------------ 381
            ||....:...||:.|:.|...||.|.|:.  ||..||.::||.||.|:..::|            
  Fly   257 GCGKSYSYLRNLRQHMLTAHSGRRFECQALDCGRCFSSAQNLARHLLRDHKDGATKKELKAKKKD 321

  Fly   382 ------------PNRYKCQLCGFSSH-RSDKM------KEHVQRVHTEKPVQLELSETVDSSFPD 427
                        .:|.:.:..|.|.| |..|:      ||..:.|...:|:.|   |.:..|..|
  Fly   322 KSKTGEGGKTKSTSRKRRRDAGRSKHSRLSKLACLQLDKEDDEAVRERQPLVL---EKITQSLKD 383

  Fly   428 DFELPVIE 435
            |   ||.|
  Fly   384 D---PVEE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 65/298 (22%)
C2H2 Zn finger 214..234 CDD:275368 5/21 (24%)
C2H2 Zn finger 244..264 CDD:275368 6/20 (30%)
C2H2 Zn finger 272..292 CDD:275368 8/55 (15%)
C2H2 Zn finger 300..320 CDD:275368 6/25 (24%)
C2H2 Zn finger 330..349 CDD:275368 5/18 (28%)
C2H2 Zn finger 357..377 CDD:275368 10/21 (48%)
C2H2 Zn finger 387..408 CDD:275368 7/27 (26%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 7/39 (18%)
zf-C2H2_8 67..150 CDD:292531 20/84 (24%)
C2H2 Zn finger 67..90 CDD:275368 6/23 (26%)
C2H2 Zn finger 106..126 CDD:275368 4/20 (20%)
C2H2 Zn finger 134..155 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..210 CDD:275368 2/21 (10%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..276 CDD:275368 7/22 (32%)
C2H2 Zn finger 283..302 CDD:275368 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.