DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and CG43347

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster


Alignment Length:454 Identity:104/454 - (22%)
Similarity:159/454 - (35%) Gaps:132/454 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SVSKEHELHFRE--LAQILAVTELLNLYQLQPL-------GEAKEATEIPAPGEA---------- 149
            ||..|.|||..|  :..:.|.||:....:|.||       ||.:|.:::....|.          
  Fly  1030 SVPAEFELHNVEPNVTGVFARTEVRAFTKLGPLIGQPVQTGEVREGSDMKWIFEMCEAGADKSYL 1094

  Fly   150 ----QPN---------PDP---EKKAEAVFENRQSYF----KLKNPRAV-------------KSS 181
                .||         |.|   |:....|..:||:||    .|:|...:             |.:
  Fly  1095 LCCDNPNASNWLRFVRPAPSYEERNVNLVSIDRQAYFVSCRDLRNGMELLYWSDDCNTMWRKKHT 1159

  Fly   182 SKVNYCIGCDFKCYQVQKMIEHMGSCEPSHLICSLCEVGFLDWREYDTHLR-----RHSGDLRKP 241
            .|.| |.||:.|       .||     |.:               |.||..     ..|..:|| 
  Fly  1160 EKTN-CGGCNLK-------FEH-----PLY---------------YRTHCSVFHDPSMSLTIRK- 1195

  Fly   242 FFCLQCGIRFNTRAALLVH-QPKHSTETPHICPHCGKGFKWKQGLSNHILVH-------NPEK-Q 297
            :.|..||.....:..::.| ..||..:..:.|..|.|.|.    ..|::.:|       ||.: :
  Fly  1196 YHCKVCGEPVLGKDNIMKHAAEKHDGKGAYQCQFCSKFFL----RLNYLEMHRTYGCASNPNRSR 1256

  Fly   298 MLCDVCGYSTTHMKALKSH-KLLHTG-----EFFACTVSGCKHRANRKENLKLHI-ETHKQGRDF 355
            .:||.||......:.||:| |.:|:.     ..|.|.:  |......:..|:.|. |.|.:....
  Fly  1257 PVCDFCGRKFCQPQKLKAHIKRMHSDMAEVLRDFQCKL--CSKLLGSRAALQRHSKEVHSRNSTV 1319

  Fly   356 I-CEVCGCKFSQSKNLKRHALKHTENGPNRYKC--QLCGFSSHRSDKMKEHVQRVHT---EKPVQ 414
            : |..|...|....|||.|.|.|  :|...:||  ..|..:......::.|.::||.   |:..:
  Fly  1320 VSCPRCQKLFQNRSNLKIHMLTH--SGVRPFKCAEPECNAAFTTKQCLQFHYKKVHNYTQEQMPK 1382

  Fly   415 LELS-----ETVDSSFPDDF-------ELPVIETSPKKKPKS----VKSKTIRNVNPDKRLKTL 462
            :|.|     :........||       ..|....|.:.:|:.    |...:.....|.:|.|:|
  Fly  1383 IERSVAYTFDAYSGGMKVDFLGKQTATATPASAASAQAQPRPNAAVVSPSSFTEQAPRRRRKSL 1446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 53/233 (23%)
C2H2 Zn finger 214..234 CDD:275368 3/24 (13%)
C2H2 Zn finger 244..264 CDD:275368 4/20 (20%)
C2H2 Zn finger 272..292 CDD:275368 5/19 (26%)
C2H2 Zn finger 300..320 CDD:275368 8/20 (40%)
C2H2 Zn finger 330..349 CDD:275368 4/19 (21%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
C2H2 Zn finger 387..408 CDD:275368 3/22 (14%)
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 18/73 (25%)
C2H2 Zn finger 1198..1219 CDD:275368 4/20 (20%)
C2H2 Zn finger 1227..1255 CDD:275368 8/31 (26%)
C2H2 Zn finger 1259..1280 CDD:275368 8/20 (40%)
C2H2 Zn finger 1292..1313 CDD:275368 5/22 (23%)
C2H2 Zn finger 1322..1342 CDD:275368 8/19 (42%)
zf-H2C2_2 1334..1361 CDD:290200 10/28 (36%)
C2H2 Zn finger 1350..1373 CDD:275368 3/22 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.