DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and Zbtb43

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001012094.1 Gene:Zbtb43 / 311872 RGDID:1310287 Length:503 Species:Rattus norvegicus


Alignment Length:190 Identity:40/190 - (21%)
Similarity:68/190 - (35%) Gaps:31/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 EDLVSVSKEHELHFRELAQILAVTELLNLYQLQPLGEAKEATEIPAPGEAQPNPDPEKKAEAVFE 164
            |:...|.|:.|:.|.|.|:.....|.::.|                 |.:......||....:..
  Rat   325 EEFQIVEKKVEVEFDEHAEGSNYDEQVDFY-----------------GSSMEEFSGEKLGGGLIG 372

  Fly   165 NRQSYFKLKNPRAVKSSSKVNYCIGCDFKCYQVQKMIEHMGSCEPSHLICSLCEVGFLDWREYDT 229
            ::|     :...|...|..:...:|       :::...|:|......|....|...|....:.|.
  Rat   373 HKQ-----ETALAAGYSENIEMVMG-------IKEEASHLGFSATDKLYPCQCGKSFTHKSQRDR 425

  Fly   230 HLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTETPHICPHCGKGFKWKQGLSNHI 289
            |:..|.|  .:|:.|..||.:|..:..|:.|...|:...|:.|..|.|.|.|:.....|:
  Rat   426 HMSMHLG--LRPYGCSVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWRDSFHRHV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 24/97 (25%)
C2H2 Zn finger 214..234 CDD:275368 4/19 (21%)
C2H2 Zn finger 244..264 CDD:275368 6/19 (32%)
C2H2 Zn finger 272..292 CDD:275368 6/18 (33%)
C2H2 Zn finger 300..320 CDD:275368
C2H2 Zn finger 330..349 CDD:275368
C2H2 Zn finger 357..377 CDD:275368
C2H2 Zn finger 387..408 CDD:275368
Zbtb43NP_001012094.1 BTB_POZ_ZBTB43 44..164 CDD:349536
C2H2 Zn finger 412..430 CDD:275368 4/17 (24%)
C2H2 Zn finger 438..458 CDD:275368 6/19 (32%)
zf-H2C2_2 450..473 CDD:404364 7/22 (32%)
C2H2 Zn finger 466..483 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.