DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and CG11398

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:304 Identity:72/304 - (23%)
Similarity:123/304 - (40%) Gaps:51/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FKCYQVQKMIEHMGSCEPSHLICSLCEVGFLDWREYDTHLRRHSGDLRKPFFCLQCGIRFNTRAA 256
            :|..::..::.|  :.|...|..:..|:.|.:..|...|.:..|    ..|.|.:|...|.||..
  Fly     6 YKEAEILALLPH--TYEDEELSLNTEELQFEELNERSQHQQGGS----PSFVCRRCPALFLTREE 64

  Fly   257 LLVHQPKH----STETP---HICPHCGKGFKWKQGLSNHILVHNPEKQMLCDVC-------GYST 307
            |..|:|.|    ..:||   |.|..||:.|:....|.:|:..||..:...|..|       ....
  Fly    65 LAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRNYPCPECPARFVQRSNRE 129

  Fly   308 THMKALKSHKLLHTGEFFACTVSGCKHRANRKENLKLHIET-HKQGRDFICEVCGCKFSQSKNLK 371
            .|:|.:.....||     :|...|||.|..::.....|::| |:..|:.:|:.|..:||...|.:
  Fly   130 CHLKNVHRKVYLH-----SCPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYR 189

  Fly   372 RHALKHTENGPNRYKCQLCGFSSHRSDKMKEHVQRVHT--------------EKPVQLELSETVD 422
            :|...|  .....|.|.:||....|.:....|: .||:              .:..|| :...:.
  Fly   190 KHLASH--GSAKSYGCPICGKLFGRPENRDVHL-FVHSICKAYICSVCGADYMRRNQL-IRHGLA 250

  Fly   423 SSFPDDFELPVIETSPKKKPK-SVKSKTIRNV---NPDKRLKTL 462
            |...:|   |::...|:..|. :.|:::.|:.   :.|:.|:.|
  Fly   251 SGHHND---PIVRQKPQFSPALAAKNRSQRSAIDESQDEELQWL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 57/224 (25%)
C2H2 Zn finger 214..234 CDD:275368 4/19 (21%)
C2H2 Zn finger 244..264 CDD:275368 8/19 (42%)
C2H2 Zn finger 272..292 CDD:275368 6/19 (32%)
C2H2 Zn finger 300..320 CDD:275368 4/26 (15%)
C2H2 Zn finger 330..349 CDD:275368 6/19 (32%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 387..408 CDD:275368 5/20 (25%)
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 8/19 (42%)
C2H2 Zn finger 87..107 CDD:275368 6/19 (32%)
C2H2 Zn finger 115..136 CDD:275368 4/20 (20%)
C2H2 Zn finger 144..165 CDD:275368 6/20 (30%)
C2H2 Zn finger 175..195 CDD:275368 6/19 (32%)
C2H2 Zn finger 203..223 CDD:275368 5/20 (25%)
C2H2 Zn finger 231..247 CDD:275368 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.