DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and ZBTB48

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001265576.1 Gene:ZBTB48 / 3104 HGNCID:4930 Length:688 Species:Homo sapiens


Alignment Length:644 Identity:131/644 - (20%)
Similarity:203/644 - (31%) Gaps:244/644 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HS-KVSNYLNNQRRTGQFCDLLLELDSDDSLSLSVHFCVLAAQSQFINSNQKQ-QQFSIHNPLKI 80
            || :|...||.||..||:||..|::   ..|....|:.|||..|.|..|.... ...|:..|.  
Human     8 HSVRVLQELNKQREKGQYCDATLDV---GGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPA-- 67

  Fly    81 TIRNFSCTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAVTELLNLYQ--------------- 130
                 ...:....::||||...::::..:.......|:.|.|.|.:.|.|               
Human    68 -----GFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQ 127

  Fly   131 ---------------LQPLG-EAKEATEI-----------------------PAPGEA------- 149
                           .:|.| |.:|.:..                       ||..|.       
Human   128 SGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGK 192

  Fly   150 -----QPNPDPEKK------------------------------------------AEAVFENRQ 167
                 :|.|..:||                                          .|||...|:
Human   193 LKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTRRK 257

  Fly   168 S----------------------------------------------YFKLKNPRAVKSSSKVNY 186
            |                                              |.|:.|.:  .:..|...
Human   258 SNVIRKPCAAEPALSAGSLAAEPAENRKGTAVPVECPTCHKKFLSKYYLKVHNRK--HTGEKPFE 320

  Fly   187 CIGCDFKCY-QVQKMIEHMG-SC---EPSHLICSLCEVGFLDWREYDTHLRRHSGDL-------- 238
            |..|. ||| :.:.::||.. :|   ......||:|:..|....|...|:..|:|::        
Human   321 CPKCG-KCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRVHMVSHTGEMPYKCSSCS 384

  Fly   239 ------------------------------------------------RKPFFCLQCGIRFNTRA 255
                                                            .|.|.|.:||.|.::|.
Human   385 QQFMQKKDLQSHMIKLHGAPKPHACPTCAKCFLSRTELQLHEAFKHRGEKLFVCEECGHRASSRN 449

  Fly   256 ALLVH-QPKHSTETPHICPHCGKGFKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLL 319
            .|.:| :.||..|.||:|..|...|..|..|:.|:..|..||...|.:||.:.....:|..|...
Human   450 GLQMHIKAKHRNERPHVCEFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRT 514

  Fly   320 HTGEF-FACTVSGCKHRANRKENLKLHIET-HKQGRDFICEVCGCKFSQSKNLKRHALKHTENGP 382
            ||||. |:|..  |:.|...|..|..|:.: |::||...|::||..|...:.|:.|..:|  .|.
Human   515 HTGERPFSCEF--CEQRFTEKGPLLRHVASRHQEGRPHFCQICGKTFKAVEQLRVHVRRH--KGV 575

  Fly   383 NRYKCQLCGFSSHRSDKMKEHVQ---RVHTEKPVQLELSETVDSSFPDDFELPVIETSP 438
            .:::|..||:...|...::.|::   ||....|.|.:|...:    .:|.::.|:...|
Human   576 RKFECTECGYKFTRQAHLRRHMEIHDRVENYNPRQRKLRNLI----IEDEKMVVVALQP 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 68/273 (25%)
C2H2 Zn finger 214..234 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 7/20 (35%)
C2H2 Zn finger 272..292 CDD:275368 6/19 (32%)
C2H2 Zn finger 300..320 CDD:275368 5/19 (26%)
C2H2 Zn finger 330..349 CDD:275368 5/19 (26%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 387..408 CDD:275368 6/23 (26%)
ZBTB48NP_001265576.1 BTB 16..119 CDD:306997 29/112 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..140 0/20 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..192 3/30 (10%)
C2H2 Zn finger 293..313 CDD:275368 3/21 (14%)
zf-H2C2_2 305..328 CDD:316026 7/25 (28%)
C2H2 Zn finger 321..372 CDD:275368 14/51 (27%)
SFP1 <374..459 CDD:227516 10/84 (12%)
C2H2 Zn finger 380..401 CDD:275368 0/20 (0%)
C2H2 Zn finger 409..425 CDD:275370 0/15 (0%)
C2H2 Zn finger 438..459 CDD:275368 7/20 (35%)
COG5048 <464..612 CDD:227381 47/151 (31%)
C2H2 Zn finger 467..487 CDD:275368 6/19 (32%)
C2H2 Zn finger 495..515 CDD:275368 5/19 (26%)
C2H2 Zn finger 523..540 CDD:275368 5/18 (28%)
C2H2 Zn finger 555..572 CDD:275368 5/16 (31%)
C2H2 Zn finger 580..600 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.