DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plzf and Zbtb2

DIOPT Version :9

Sequence 1:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001100930.1 Gene:Zbtb2 / 308126 RGDID:1306621 Length:514 Species:Rattus norvegicus


Alignment Length:512 Identity:108/512 - (21%)
Similarity:170/512 - (33%) Gaps:154/512 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SQTMQSIPTLHQPLHSKVSNYLNNQRRTGQFCDLLLELDSDDSLSLS-----------VHFCVLA 57
            |:.::..||..||   .:.:||.:...||:....|:     |.:.|.           :....||
  Rat    58 SECVRLKPTDIQP---DIFSYLLHLMYTGKMAPQLI-----DPVRLEQGIKFLHAYPLIQEASLA 114

  Fly    58 AQSQFINSNQKQQQFSIHNPL-KITIRNFSCTQCLHTIVDFFYEDL-----VSVSKEHELHFREL 116
            :|..|   :..:|.|.:.:.| .|.|.:....|.  |.::...|.|     ...|:.::....|.
  Rat   115 SQGTF---SHPEQVFPLASSLYGIQIADHQLRQA--TKMNLGPEKLGREPRPQASRMNQEPVPET 174

  Fly   117 AQILAVTELL------NLYQLQPL--GEAKEATEIPAPGEAQPNPDPEKKAEAVFENRQSYFKLK 173
            :|:..:|..|      |:....||  ..:.|....|.|   .|.|..|...||...:.|      
  Rat   175 SQLSQLTSNLAQVNRTNMTPADPLQTSLSPELVSTPVP---PPPPGEETNLEASSSDEQ------ 230

  Fly   174 NPRAVKSSSKVNYCIGCDFKCYQVQKMIEHMGSCEPSHLICSLCEVGFLDWREYDTHLRRHSGDL 238
             |.::                     .|.|:   :||                    :.:.:|..
  Rat   231 -PSSL---------------------TIAHV---KPS--------------------IMKRNGSF 250

  Fly   239 RKPFFCLQCGIRFNTRAALLVHQPKHSTETPHICPHCGKGFKWKQGLSNHILVHN---------- 293
            .|.:.|..||.||..|::|..|...| |..|......|:|   :..||   |..|          
  Rat   251 PKYYACHLCGRRFTLRSSLREHLQIH-TGVPFTAGPPGEG---RGPLS---LCSNAADLGKDALE 308

  Fly   294 -PEKQMLCDVCGYSTTHMKALKSHKLLHTGEFFACTVSGCKHRANRKENLKLHIETHKQG----- 352
             ||..|:.|              .:|.|..:  :..:.|.:.......:....|:..:|.     
  Rat   309 VPEAGMISD--------------SELQHISD--SPIIDGQQQSETPPPSDIADIDNLEQADQERE 357

  Fly   353 ---RDFICEVCGCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHV---QRVHTEK 411
               |.:.|.:||.||.|..:.:.|...||   ...:||..|..|..|:::...||   |.:.|..
  Rat   358 VKRRKYECTICGRKFIQKSHWREHMYIHT---GKPFKCSTCDKSFCRANQAARHVCLNQSIDTYT 419

  Fly   412 PVQ---LELSETVDSSFPDDFELPVIETSPKK---------KPKSVKSKTIRNVNPD 456
            .|.   |||....:.|..|:  :.|....|.|         .|..|...:.:|.|.|
  Rat   420 MVDKQTLELCTFEEGSQMDN--MLVQANKPYKCNLCDKTFSTPNEVVKHSCQNQNSD 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 47/228 (21%)
C2H2 Zn finger 214..234 CDD:275368 0/19 (0%)
C2H2 Zn finger 244..264 CDD:275368 8/19 (42%)
C2H2 Zn finger 272..292 CDD:275368 5/19 (26%)
C2H2 Zn finger 300..320 CDD:275368 2/19 (11%)
C2H2 Zn finger 330..349 CDD:275368 2/18 (11%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 387..408 CDD:275368 7/23 (30%)
Zbtb2NP_001100930.1 BTB_POZ_ZBTB2 3..117 CDD:349502 14/66 (21%)
zf-C2H2 254..276 CDD:395048 8/21 (38%)
C2H2 Zn finger 256..276 CDD:275368 8/19 (42%)
zf-C2H2 363..385 CDD:395048 7/21 (33%)
C2H2 Zn finger 365..385 CDD:275368 7/19 (37%)
zf-H2C2_2 377..399 CDD:404364 6/24 (25%)
C2H2 Zn finger 392..416 CDD:275368 7/23 (30%)
C2H2 Zn finger 450..466 CDD:275368 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.