Sequence 1: | NP_001285862.1 | Gene: | Plzf / 34622 | FlyBaseID: | FBgn0032401 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_862827.2 | Gene: | BCL6B / 255877 | HGNCID: | 1002 | Length: | 479 | Species: | Homo sapiens |
Alignment Length: | 250 | Identity: | 73/250 - (29%) |
---|---|---|---|
Similarity: | 98/250 - (39%) | Gaps: | 53/250 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 136 EAKEATEIPAPGEAQPNPDPEKKAEAVFENRQSYFKLKNPRAVK--SSSKVNYCIGCDFKCYQVQ 198
Fly 199 KMIEHMGSCEPSHLICSLCEVGFLDWREYDTHLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPK 263
Fly 264 HSTETPHICPHCGKGFKWKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLLHTGEF-FAC 327
Fly 328 TVSGCKHRANRKENLKLHIETHKQGRDFICEVCGCKFSQSKNLKRHALKHTENGP 382 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Plzf | NP_001285862.1 | COG5048 | <193..403 | CDD:227381 | 59/190 (31%) |
C2H2 Zn finger | 214..234 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 244..264 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 272..292 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 300..320 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 330..349 | CDD:275368 | 6/18 (33%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 387..408 | CDD:275368 | |||
BCL6B | NP_862827.2 | BTB_POZ | 19..132 | CDD:365784 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 143..190 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 210..259 | ||||
C2H2 Zn finger | 330..350 | CDD:275368 | 5/19 (26%) | ||
COG5048 | 354..>411 | CDD:227381 | 24/56 (43%) | ||
C2H2 Zn finger | 358..378 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 370..395 | CDD:372612 | 10/24 (42%) | ||
C2H2 Zn finger | 386..406 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 412..434 | CDD:333835 | 8/21 (38%) | ||
C2H2 Zn finger | 414..434 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 427..451 | CDD:372612 | 11/25 (44%) | ||
C2H2 Zn finger | 442..460 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |